CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
CP029553	Methylobacterium sp. 17Sr1-28 chromosome, complete genome	3 crisprs	WYL,cas3,csa3,cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,DEDDh	0	53	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP029553_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029553_3

3235997-3236636

Orphan

Consensus_repeat	Method
GGCTC---CCCCGCCCACGCGGGGATCGACC	PILER-CR
GGCTCCCCCGCCCACGCGGGGATCGACCC	CRISPRCasFinder
GGCTCCCCCGCCCACGCGGGGATCGACCC	CRT

10 spacers

The CRISPR arrays of CP029553_3

>merge|CP029553|3|3235997-3236636|PILER-CR,CRISPRCasFinder,CRT
GGCTCCCCCGCCCACGCGGGGATCGACCCCTCGAGTCCCGGCAGCGCCGGCGCCTCGTCGGGGCTCCCCCGCCCACGCGGGGATCGACCCCTGAGTCATGGATCGTCGTGTCCGTGTCGGCTGGCTCCCCCGCCCACGCGGGGATCGACCCGAGGCGATGCCGCGGGACAGCATCCGGTCCCGGGCTCCCCCGCCCACGCGGGGATCGACCCAGGATTCGATGTGCCGCCGCTGTCGATTTCGAGGCTCCCCCGCCCACGCGGGGATCGACCCCCCAAGGGCGGCTTTACCTGCGTCACGGTCGTGGCTCCCCCGCCCACGCGGGGATCGACCCCGGCCGCGGCCGCACCGCACTTGCACGGTCATGGCTCCCCCGCCCACGCGGGGATCGACCGTCCGGGTCCGCGGCGAGGTTGGACCGCAGCTTGGCTCCCCCGCCCACGCGGGGATCGACCCGTCGCACGCATCTAGGCGTTAGCGAAATCGGTGGCTCCCCCGCCCACGCGGGGATCGACCTGTCGACGCTCGGGGCCGTCACGAAGGTCAGGGGGGCTCCCCCGCCCACGCGGGGATCGACCCTTCCCGATCGGGATCGTCGTCCTGCAGCCGGTGCCTTCCCCGCCTACGCGGGGGTCAACCC

>CP029553|3|1|3235997-3236574|PILER-CR
GGCTCCCCCGCCCACGCGGGGATCGACC	CCTCGAGTCCCGGCAGCGCCGGCGCCTCGTCGG
GGCTCCCCCGCCCACGCGGGGATCGACC	CCTGAGTCATGGATCGTCGTGTCCGTGTCGGCT
GGCTCCCCCGCCCACGCGGGGATCGACC	CGAGGCGATGCCGCGGGACAGCATCCGGTCCCG
GGCTCCCCCGCCCACGCGGGGATCGACC	CAGGATTCGATGTGCCGCCGCTGTCGATTTCGA
GGCTCCCCCGCCCACGCGGGGATCGACC	CCCCAAGGGCGGCTTTACCTGCGTCACGGTCGT
GGCTCCCCCGCCCACGCGGGGATCGACC	CCGGCCGCGGCCGCACCGCACTTGCACGGTCAT
GGCTCCCCCGCCCACGCGGGGATCGACC	GTCCGGGTCCGCGGCGAGGTTGGACCGCAGCTT
GGCTCCCCCGCCCACGCGGGGATCGACC	CGTCGCACGCATCTAGGCGTTAGCGAAATCGGT
GGCTCCCCCGCCCACGCGGGGATCGACC	TGTCGACGCTCGGGGCCGTCACGAAGGTCAGGGG
GGCTCCCCCGCCCACGCGGGGATCGACC

>CP029553|3|3|3235997-3236636|CRISPRCasFinder
GGCTCCCCCGCCCACGCGGGGATCGACCC	CTCGAGTCCCGGCAGCGCCGGCGCCTCGTCGG
GGCTCCCCCGCCCACGCGGGGATCGACCC	CTGAGTCATGGATCGTCGTGTCCGTGTCGGCT
GGCTCCCCCGCCCACGCGGGGATCGACCC	GAGGCGATGCCGCGGGACAGCATCCGGTCCCG
GGCTCCCCCGCCCACGCGGGGATCGACCC	AGGATTCGATGTGCCGCCGCTGTCGATTTCGA
GGCTCCCCCGCCCACGCGGGGATCGACCC	CCCAAGGGCGGCTTTACCTGCGTCACGGTCGT
GGCTCCCCCGCCCACGCGGGGATCGACCC	CGGCCGCGGCCGCACCGCACTTGCACGGTCAT
GGCTCCCCCGCCCACGCGGGGATCGACCG	TCCGGGTCCGCGGCGAGGTTGGACCGCAGCTT
GGCTCCCCCGCCCACGCGGGGATCGACCC	GTCGCACGCATCTAGGCGTTAGCGAAATCGGT
GGCTCCCCCGCCCACGCGGGGATCGACCT	GTCGACGCTCGGGGCCGTCACGAAGGTCAGGGG
GGCTCCCCCGCCCACGCGGGGATCGACCC	TTCCCGATCGGGATCGTCGTCCTGCAGCCGGT
GCCTTCCCCGCCTACGCGGGGGTCAACCC

>CP029553|3|1|3235997-3236636|CRT
GGCTCCCCCGCCCACGCGGGGATCGACCC	CTCGAGTCCCGGCAGCGCCGGCGCCTCGTCGG
GGCTCCCCCGCCCACGCGGGGATCGACCC	CTGAGTCATGGATCGTCGTGTCCGTGTCGGCT
GGCTCCCCCGCCCACGCGGGGATCGACCC	GAGGCGATGCCGCGGGACAGCATCCGGTCCCG
GGCTCCCCCGCCCACGCGGGGATCGACCC	AGGATTCGATGTGCCGCCGCTGTCGATTTCGA
GGCTCCCCCGCCCACGCGGGGATCGACCC	CCCAAGGGCGGCTTTACCTGCGTCACGGTCGT
GGCTCCCCCGCCCACGCGGGGATCGACCC	CGGCCGCGGCCGCACCGCACTTGCACGGTCAT
GGCTCCCCCGCCCACGCGGGGATCGACCG	TCCGGGTCCGCGGCGAGGTTGGACCGCAGCTT
GGCTCCCCCGCCCACGCGGGGATCGACCC	GTCGCACGCATCTAGGCGTTAGCGAAATCGGT
GGCTCCCCCGCCCACGCGGGGATCGACCT	GTCGACGCTCGGGGCCGTCACGAAGGTCAGGGG
GGCTCCCCCGCCCACGCGGGGATCGACCC	TTCCCGATCGGGATCGTCGTCCTGCAGCCGGT
GCCTTCCCCGCCTACGCGGGGGTCAACCC

Protein	Signature genes	Signature genes Name	Protein_function
CP029553.1\|AWN47442.1\|3223008_3223884_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119324
CP029553.1\|AWN47447.1\|3233116_3233842_+\|DUF159-family-protein	unknown	unknown	gnl\|CDD\|376837
CP029553.1\|AWN47453.1\|3239995_3240826_+\|semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|374872
CP029553.1\|AWN47456.1\|3248731_3250192_+\|succinate-semialdehyde-dehydrogenase-(NADP(+))	unknown	unknown	gnl\|CDD\|143421
CP029553.1\|AWN47452.1\|3239125_3239854_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN50065.1\|3231427_3231913_+\|cys-tRNA(pro)/cys-tRNA(cys)-deacylase	unknown	unknown	gnl\|CDD\|239825
CP029553.1\|AWN47449.1\|3236799_3237639_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|131338
CP029553.1\|AWN47444.1\|3225641_3228059_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227334
CP029553.1\|AWN47443.1\|3224143_3225409_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380568
CP029553.1\|AWN47445.1\|3228194_3230723_-\|ATP-dependent-helicase-HrpB	unknown	unknown	gnl\|CDD\|273901
CP029553.1\|AWN47454.1\|3246594_3247566_-\|glyoxylate/hydroxypyruvate-reductase-A	unknown	unknown	gnl\|CDD\|240641
CP029553.1\|AWN47455.1\|3247926_3248595_+\|haloacid-dehalogenase-type-II	unknown	unknown	gnl\|CDD\|319787
CP029553.1\|AWN47446.1\|3232073_3233069_+\|magnesium-and-cobalt-transport-protein-CorA	unknown	unknown	gnl\|CDD\|213371
CP029553.1\|AWN47457.1\|3250269_3251118_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|380091
CP029553.1\|AWN47448.1\|3234072_3235908_+\|glycoside-hydrolase-family-15-protein	unknown	unknown	gnl\|CDD\|225922
CP029553.1\|AWN47450.1\|3237818_3238661_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|131338
CP029553.1\|AWN47451.1\|3238688_3238928_-\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN50066.1\|3251178_3251640_-\|AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
CP029553.1\|AWN47441.1\|3222032_3222959_-\|branched-chain-amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|119323
CP029553.1\|AWN50064.1\|3230931_3231228_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
CP029553.1\|AWN47442.1\|3223008_3223884_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119324	cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	1.16008e-52
CP029553.1\|AWN47447.1\|3233116_3233842_+\|DUF159-family-protein	gnl\|CDD\|376837	pfam02586, SRAP, SOS response associated peptidase (SRAP). The SRAP family functions as a DNA-associated autoproteolytic switch that recruits diverse repair enzymes onto DNA damage. We propose that the human protein Q96FZ2:UniProtKB, the eukaryotic member of the SRAP family, which has been recently shown to bind specifically to DNA with 5-hydroxymethylcytosine, 5-formylcytosine and 5-carboxycytosine, is a sensor for these oxidized bases generated by the TET (tetrahedral aminopeptidase of the M42 family) enzymes from methylcytosine. Hence, its autoproteolytic activity might help it act as a switch that recruits DNA repair enzymes to remove these oxidized methylcytosine species as part of the DNA demethylation pathway downstream of the TET enzymes.	1.10334e-97
CP029553.1\|AWN47453.1\|3239995_3240826_+\|semialdehyde-dehydrogenase	gnl\|CDD\|374872	pfam16896, PGDH_C, Phosphogluconate dehydrogenase (decarboxylating) C-term. PGDH_C is the C-terminal domain of putative bacterial phosphogluconate dehydrogenase proteins.	2.21761e-98
CP029553.1\|AWN47456.1\|3248731_3250192_+\|succinate-semialdehyde-dehydrogenase-(NADP(+))	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
CP029553.1\|AWN50065.1\|3231427_3231913_+\|cys-tRNA(pro)/cys-tRNA(cys)-deacylase	gnl\|CDD\|239825	cd04333, ProX_deacylase, This CD, composed mainly of bacterial single-domain proteins, includes the Thermus thermophilus (Tt) YbaK-like protein, a homolog of the trans-acting Escherichia coli YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium tumefaciens ProX Ala-tRNA(Pro) deacylase and also the cis-acting prolyl-tRNA synthetase-editing domain (ProRS-INS). While ProX and ProRS-INS hydrolyze misacylated Ala-tRNA(Pro), the E. coli YbaK hydrolyzes misacylated Cys-tRNA(Pro). A few CD members are N-terminal, YbaK-ProX-like domains of an uncharacterized protein with a C-terminal, predicted Fe-S protein domain.	7.0546e-66
CP029553.1\|AWN47449.1\|3236799_3237639_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|131338	TIGR02285, conserved_hypothetical_protein, conserved hypothetical protein. Members of this family are found in several Proteobacteria, including Pseudomonas putida KT2440, Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472. The function is unknown. [Hypothetical proteins, Conserved].	3.17817e-36
CP029553.1\|AWN47444.1\|3225641_3228059_-\|hypothetical-protein	gnl\|CDD\|227334	COG5001, COG5001, Predicted signal transduction protein containing a membrane domain, an EAL and a GGDEF domain [Signal transduction mechanisms].	1.27192e-118
CP029553.1\|AWN47443.1\|3224143_3225409_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380568	cd06345, PBP1_ABC_ligand_binding-like, type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.	1.15602e-153
CP029553.1\|AWN47445.1\|3228194_3230723_-\|ATP-dependent-helicase-HrpB	gnl\|CDD\|273901	TIGR01970, ATP-dependent_RNA_helicase_HrpB, ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. [Unknown function, Enzymes of unknown specificity].	0
CP029553.1\|AWN47454.1\|3246594_3247566_-\|glyoxylate/hydroxypyruvate-reductase-A	gnl\|CDD\|240641	cd12164, GDH_like_2, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family. This group contains a variety of proteins variously identified as glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase) and other enzymes of the 2-hydroxyacid dehydrogenase family. GDH catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. 2-hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	5.05144e-149
CP029553.1\|AWN47455.1\|3247926_3248595_+\|haloacid-dehalogenase-type-II	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	1.30692e-58
CP029553.1\|AWN47446.1\|3232073_3233069_+\|magnesium-and-cobalt-transport-protein-CorA	gnl\|CDD\|213371	cd12837, EcCorA-like_u1, uncharacterized subgroup of the Escherichia coli Mg2+ transporter CorA_like subfamily. A uncharacterized subgroup of the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. The EcCorA_ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA_ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	4.82464e-160
CP029553.1\|AWN47457.1\|3250269_3251118_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|380091	pfam18014, Acetyltransf_18, Acetyltransferase (GNAT) domain. This entry represents a likely acetyltransferase enzyme that is related to pfam06852.	5.42207e-18
CP029553.1\|AWN47448.1\|3234072_3235908_+\|glycoside-hydrolase-family-15-protein	gnl\|CDD\|225922	COG3387, SGA1, Glucoamylase and related glycosyl hydrolases [Carbohydrate transport and metabolism].	5.44803e-86
CP029553.1\|AWN50066.1\|3251178_3251640_-\|AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	1.11805e-39
CP029553.1\|AWN47441.1\|3222032_3222959_-\|branched-chain-amino-acid-ABC-transporter-permease	gnl\|CDD\|119323	cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins. LivM is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivM forms a heterodimer with another TM, LivH, to generate the transmembrane pore. LivH is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transporting branched-chain AAs including leucine, isoleucine and valine, the E. coli LIV-1/LS transporter is involved in the uptake of the aromatic AA, phenylalanine.	9.84126e-46
CP029553.1\|AWN47450.1\|3237818_3238661_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|131338	TIGR02285, conserved_hypothetical_protein, conserved hypothetical protein. Members of this family are found in several Proteobacteria, including Pseudomonas putida KT2440, Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472. The function is unknown. [Hypothetical proteins, Conserved].	5.13028e-35

>CP029553.1|AWN47448.1|3234072_3235908_+|glycoside-hydrolase-family-15-protein
MHDPDARPYQPIEAYGLISNCHGCALVARDGSIDWACLERFDAPPVFSRLLDRRRGGFFALAPETPFESARLYLPGTNILETTFTCATGAATVHDFMLAPEPGRALPCLVRLVSGVSGHVPMRAAYRPLAGFATRFPDLVAVPGGAGAEGLPDLIADLDLTVEGGEAVARFTIAHGGEQSFALFSGGAGDREALRPRDLMEAARRSWIGWSAGAAYDGPLADQLLRSALTLKALTYAPSGAIVAAATTSLPEEIGGIRNWDYRFCWIRDACLSFYVLKKFGMVAEAEAFFRFVGGLAERDEGGLKPLYAIAGEADLSEHEAAHFEGWRGSAPVRYGNEAAEQHQSDAYGQVLDLLHLYHSLGGTIPDAMARQAVRLADFAAAHWHETDAGLWEPRKPEQHYLHAAIMNWVAVDRAIRLFGERPHWREARDAIVARVNGEGVHRDGYYPQYLGGDDPDAALLIAPMVGFPVDEAAFARTVDVVIARLGHGPLVYRYRNDDGLPGHEGTFLICAFWLVDALAWLGRTEEAQTRFDALRALQNDVGLYAEEVAEDRTFLGNFPQAFSHLAFIHSALVLDLAHQGGREAVAGTYADRTLRETRWRRVPWIVPPAE
>CP029553.1|AWN47447.1|3233116_3233842_+|DUF159-family-protein
MCGRFFVTSSPETFREAYAYDDRPNFPARHNVAPTQPVAVVTAEHGRRRFVLMRWGFLPAWVKDPADFPLVINARIETAAEKPSFRNALRYRRCVVLADGFYEWRRGGPRGQAPYAIRRADRRPMALAGLWETWSSRDGSEIDTAAIVTCGANGLLAAIHERMPAILSPEGVDRWLDMRDVDAGQAAALCRPAPEKWLDLAPASRQVNDVRHDEAGLLRPDEDAPAPPPPERKTEAQGSLF
>CP029553.1|AWN47446.1|3232073_3233069_+|magnesium-and-cobalt-transport-protein-CorA
MIFVHQPNACASTGQPLLERRLLEMSEPIPPDALWIDLIEPTRQEDHKVEAFLGISIPTREEMEDIEPSELLYVENGARYMTGRLLCRVDTDDARLTGVTFILRDNKLATVRYDDPQAFRMFVHRAARPAGVMLTGEAILAGLIETVIDRAADVLQAQGERIDRLSRRIFAEHSDPSARNAELQDTLRALGRHNELLSQQRESLVSVERILLSLSASYRASKAPREVREEIRSTLRDLQSLEEHASFLSGKIQFLLDATLGLVNLEQNNIIKLFSVMAVVFMPPTLIASMYGMNFKVMPELDWGFGYPMAVVMMVVAAILPYAFFRWKRWL
>CP029553.1|AWN50065.1|3231427_3231913_+|cys-tRNA(pro)/cys-tRNA(cys)-deacylase
MSLASVKADLAVRAPDLTVLETEASSATVALAAAAHGVEPARIAKTLSLRLGERIVLLVARGDARLDNRKARAAFGVKPRMLGAEEVEAITGHPVGGVCPFGLATPLTVYCDVSLKAFDEVVPAAGSPNSAVRVSPERMAALTGAEWIDVCQPPEAGEPAA
>CP029553.1|AWN50064.1|3230931_3231228_+|hypothetical-protein
MKSLTLALAASVLLGGLALTPASAAVTGPAPAVAGAESTVEHVAMRRHRHYHRMKRHDRHMRRHMRRNHMRAGDPNARNPSRPGYQQQLGNTTGGPRY
>CP029553.1|AWN47445.1|3228194_3230723_-|ATP-dependent-helicase-HrpB
MRSAPSLPIDAVLGDLAAALAAPSAQGRPNAVLVAPPGAGKTTRVPLTLLDAPWRGDRRIILLEPRRLAARAAAERMAASLSEAVGETVGLRVRLGSKVSARTRIEVVTEGVFARMILDDPELDGVAAVLFDEFHERSLDADLGLALALDAQGGLREDLRLLAMSATIDGARVAALMGQGHENPAPVIVSEGRAFTVETRHLDRDPQGRIEDAVTDAVMRALRAEPGSVLAFLPGQAEIRRTEERLRARLAEVPDIDLAPLYGALDRAEQDRAVRPSPAGRRKVVLATSIAETSLTIEGVRVVVDSGLARVPVYEPDLGLTRLVTQRASRASVDQRRGRAGRTQAGVCYRLWPEAATGALEPFTRPEILAADLAGLVLDCAAWGVSDPTTLPFLDPPPAPALAEARALLAGLDALDAGGRLTPAGRALRALPLPPRLARMVVSAAATGRDAARLAADVAAVLVERGLGGDAVDLTERVERYRRDRAGRSEDMRRLAAGWARMAATTTEPAGAGETPDIGTPDVGALVALAYPDRIARARGRPGEYVLANGRGAALDPAAGLAREPFLAVAEIVGKASAARILAAAPIALSAVEALFADRIEARTRVEFDPDARALRARAQRRLGAVSLAERILPVPADADSAAILARGLASLGVSALPWSKAAQQWRERVTFLRSAEGEPWPDLSDPALAEALPDWLGPHLTGITRLDEIGADRLSDALHDLVPWALRARLDAEAPTHIEVPTGSRIPVDYAAEGGPVLAVRVQELFGLTRHPTIGGGRVPLVLHLLSPAQRPIQITRDLPGFWRGSWAAVRADMRGQYPRHPWPEDPTTAPPTRRAKPRGT
>CP029553.1|AWN47444.1|3225641_3228059_-|hypothetical-protein
MLPDDLDTIAADWSWETDADLRLTAVRGRYAALTGEAAPIGRPWPGLDGDGPPDDAPLRGRAPFRDHVLAHRHRDGRTRWFRFGGAPRHAPDGSIAGWRGVCAEVPGSPAGPDERARCLEAQARCLEAQARRFAAAVENMPIGVSVFDADLRLIAFNDRLRDLYDLPAGLMRPGTPIETMIRASARLGNYPGLTPDEACAFVAERVGRRVRLQRERLLPSGLLLRTTIAPLPDGSTMVVHEDATDRARADAALAEQNRRLDHALTHMSHGLVLFDAEHRVTVVNRQFLDLYGLSPETVHPGITAEELIHRRTEAGNFPGLAPEEAWRQVSVRLATRTRYRLDQTLVDGRVIAVTYAPTPEGGFVTVHEDVTAAKRAEAQIVHMARHDALTGLPNRALLHEGLADALGRGGGGTAVLCLDLDRFKTVNDTLGHAVGDKLLRQVAARLAAEIRDEAGTGLATLARLGGDEFAVVLTPTSRFRAGRLAGRLIAAVGRDYDIDGKRIAVGLSVGLALAPADGQDPEGLMRAADLALYRAKAEGRGTHRFFEPAMDVAIQARRTVEIDLRTALAEQHFALAFQPFLGLSGDRIAGFEALLRWHHPVRGVVSPAAFVPVAEETGMIVPLGEWVLRQACREAARWPEGVRVSVNLSPVQFRGGDIDAVVIAALRDAGLDPRRLELEITEGVLLQDSESTLAILHRLKRLGVRIAMDDFGTGYSSLGYLRAFPFDKIKIDRSFVADLSVRPDALAIVRAVTTLADSLGMTTTAEGVETEEQLAHLRAAGCTEVQGYLISRPVPADAVAPMLGA
>CP029553.1|AWN47443.1|3224143_3225409_-|ABC-transporter-substrate-binding-protein
MLECASVARRRLVRALLGSTILLAANASLSTVQAADPIRIAVIAEAQAIAGAAIPQAAQLAADEINAKGGMDGRKIEIITYDNKSSAADSVRAFQRAASEDKAHAVIASYISEVVLALQPWSARLKLPFITPGAASNEIPLNVHKDYARYKYSFHGYLTSKAQSQAVCDAAKAILAEGRQMKTAVIMSEDAAWTKPLDEGYKECLPKAGLKVLDHIRFSPSTTDFNPIFSRIEGAKPDVIVTGISHVGVQPTVQWRSQQVPIPMVGIASQATNATFWKETNGATEGVLFEMFAAPGTNVTPKTAPFAEAFKAKYGSYPGYAGYTAYDEVYYIADAVKRAGSTDPDKLVEALETTDWEGTLGRIQFYGKDDEFTHSIKYGPGLVSGMMMQWQDGKQLAIWPSTVANGKMTFPSFVKAGTAAN
>CP029553.1|AWN47442.1|3223008_3223884_-|branched-chain-amino-acid-ABC-transporter-permease
MTAIQILIDGFAISALYALGATGFTLIFGVSGVLNLSHGALMVTAAVVAWAASSEYGLGSYAGAAAGVAVCTGLTLATYGVVVRPIDRSRAIPPEEKEIFILTGTLLWGIMIQEFIAYLFTSNAKTVMPIVEGVVTIAGVRTPWNQVFTAVVCWATIGLLWLLVNRTRTGKVLLAASMNPRGVTLLGFELSRIYVAIWLIYGVLAGIAGVLLGQFLGVSSYSVGPLTASAFSIVVLGGLGSVSGSLIAAYVVGYLETLTAYLVSPAYRTIPALLLLVAVMYVRPQGLLGRR
>CP029553.1|AWN47441.1|3222032_3222959_-|branched-chain-amino-acid-ABC-transporter-permease
MLAKTLRNPLFWLCLIGLALASVLPLWVSGYILGLLTVAYYFGVFSMAWDLLFGFAGEVNFGPTFLIGLGAYTAGILNGHGVGIPLCLLAGTVAAVIGGLVLALPALRVRGPYFGLTTVVAVLILQNLIVVFADTTGGEIGLTVPDVISIDAATNYWIALGFMGVSGLILYAIAVSPVGLILQASGQDPVEAGALGFNVAKHKLAAFCVSAVFSGLAGALFVFYMGTASVGTLVDVSVGVQVIIGAVLGGRRTIVGGVLGAVFLIAAGELLRPLGSLSTFVVSAAALAVILFVPAGLLGILTRQGRHA
>CP029553.1|AWN47449.1|3236799_3237639_+|ABC-transporter-substrate-binding-protein
MVKRRGFAGLLVALGLVTSAPAGARQLTWSVFDAPPFTIVEGENRGRGVFDRIRHFLAARLGDYAVTSVTVPFPRIVASLKTGEEWCFVGGVKTPEREVFAAFSRPVAMFYPLRIVVPAAKRAQFEALKPLSLRSLLAERRDLRTSVLRDRAIAPEVDALLRQYPPGQTYAHFIEAYRMLMNDRLDYLVDFSSITAYNARQLARPGAFVGLPFAESPEPVFARVMCAGTPWGREVVARIDAVLAAERASPEYRRIVEAWTAEEDLPRIRAVYDTFLASE
>CP029553.1|AWN47450.1|3237818_3238661_+|ABC-transporter-substrate-binding-protein
MVKRRGLAGLVVALALAGPARAEDKQITWSVYNAAPFMMTEGEDRDAGIFDRIRGLLSARLTDYAHTTLTVPFPRILTSLKNREEWCFVGGVKTPEREVFAVFSRPVAMFYPLRVIVPAAKRARFDALGPLSLRDLLVVHRDLRTSLLRNRAFAPVVDGLFRDHPPGQTHSEFAEAFRMLRNDRLDYLVEYSNIAAYYNTGEFGVPNALVGLPFAENPEPTFARVMCAGTPWGREVVARIDAVLAAERASPEYRRIVEAWTAQEDLPRIRAVYDAFLASD
>CP029553.1|AWN47451.1|3238688_3238928_-|hypothetical-protein
MTRYRFHCTNGSECILDAEGTLLRGPAALGRHARQVAAAAMRSLGADADWTEWRVSVHDLTGRRVWVEPFVVWEAALAA
>CP029553.1|AWN47452.1|3239125_3239854_+|hypothetical-protein
MAGVFDPILNWRLLPGSHAFPGPDGGTCINEAAVVAAGLPYRAIRSSADCPPCFSAPLATYALGLNDAMPDAERPRLMAFVLRLAGSADGEAVEAARIAHLVREGVRRLLPPVLERAGLPQHAAACRSAADLERAVTVARHAAWSAGSLAEAAGRQGTWVRGARAAAAARAALFAAENDARTAADAAEAAALFWPGAWAEAVAILDEGLLLGRQAPALGSEEAGMRLEAAKAGRRARAGAAA
>CP029553.1|AWN47453.1|3239995_3240826_+|semialdehyde-dehydrogenase
MTEKIALFGAGGKMGVRLARNLVNTDFRLAPVEVGEAGRRRLETELGLACVEVDAALDGAEVVVLAVPDTLIGRVSHDLSPKLKPGTMVVILDAAAPFAGHLPERPDLTYFVTHPCHPPIFNDETTEEGRRDHFGGIAARQSIVSALMQGPEEAYALGERVARAIWAPILRSHRVTVEQMALLEPGLSETVCATLLAVMREAMDETVRRGVPEVCARDFLLGHLNILAAVTFREVDGVFSDACNKAIQYGKPRLMRDDWLDCLDEHEVAESIRRIT
>CP029553.1|AWN47454.1|3246594_3247566_-|glyoxylate/hydroxypyruvate-reductase-A
MTITKTTTETAAPPTPLIAYKSDPVRGAVWHDIFAREAPDLRLVDWEPDGEAAEAPYLVAWTPPADLPRAMPRLEALFCIGAGIDHLPVGALPPAVQVVRMVDPNLTASMVEYVVMAVLALHRDLPFYRVEQAAGRWTPRPVLPATERRVGVMGLGVLGQAAARAVAGFGFPVRGWSASPKSLDGIETFAGDDALGDFLSGTDILVCLLPLTATTRGILDRALFDRLPRGAGLVNAGRGGHAVEADLLAALDDGRLSGAILDVLAAEPPAPGHPLLAHPRVMATPHVASATQPAGAARQVIRGVRAHLRGEPIPHAIDRSQGY
>CP029553.1|AWN47455.1|3247926_3248595_+|haloacid-dehalogenase-type-II
MAHLKPKYITFDCYGTLIYFEMAPVARRLYADRVPKERMDAFVADFSAYRLDEVLGPWKPYKDVVANSLIRTCKLNGVEYRDSDADAVYAEVPTWGPHPDTVEGLAKVAKEFPLVILSNSMKDLIPHSVAKLGAPFHAAYTAEEAQAYKPRMQAFEYMFDQLGCGPEDVLHCSSSFRYDLMTAHDLRITNKVWVNRGHEPANPYYGYHEIKDIRGLPGLLGL
>CP029553.1|AWN47456.1|3248731_3250192_+|succinate-semialdehyde-dehydrogenase-(NADP(+))
MFSQDRLRDPALLRFQASIAGEWRDAESGASLAVTDPATGETLGTVPDCGASETRAAIMAAEAAFPAWRRTAPAERAAILERWNALILENAEDLAAIMTAEQGKPLAEARGEVAYGASFVKWFAEEARRITGDVFTAPVGDRRVLVLKEPVGVCAAITPWNFPIAMITRKVAPAFAAGCPIVVKPADLTPFSALALAVLAERAGVPKGVFSVVTGQAAPIGAEMTGSETVRKLSFTGSTAVGRLLMAQSAPTIKRLSLELGGNAPFIVFDDADLDQAIAGVMASKFRNAGQTCVCANRILVQDGIHDRFAARLAEAAARLRVGNGFEAGVTIGPLINDAAAAKVTAHLDDALKHGARLVAGDPDAVRGRFVPPLVLTGAETGMRLATEETFGPLAPLMRFSREEDAIAVANATPFGLASYFYTSDIRRAWRVGEALEFGMVGLNTGTVSMEAAPFGGVKQSGLGREGSAYGIDEYLELKSLHMGGL
>CP029553.1|AWN47457.1|3250269_3251118_+|GNAT-family-N-acetyltransferase
MTNETNGPTIRPMIAADIAAAHGLSVEVRWPHGADDWRLMLELGHGLVACDEEGRVMGSAMWWPFGEGLATIGMVIVSPRRQANGTGRRLMRELFSAAGDRTIRLTSTEAGRRLYESEGFRVTGGLTQYHGTADAAAAVEDARVRPATEADWPGLVALDREASGGDRVRLLEALRRVGAITVLEEGGRIAGYACCRPFGRGHLVGPIVAADGGSAVALASPHVRTHAGTFLRLDTTERDGPLAAFAQACGLANVDEPVTMTRGTIPEAGPARIFAVASQALG
>CP029553.1|AWN50066.1|3251178_3251640_-|AsnC-family-transcriptional-regulator
MKILIELQKNGRMTNVTLADAVGLSASPCLLRVKRMEQAGYITGYGAHIALPKLGETVTVFTEFTLNGHTPEYFQRFEQALRKIDEAIEGHVVSGGYDYLVKFVTRGLSHYQEVIEALLERNVGIAKYFSYIVLRTPIVKTELPLAALFGEER

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029553_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029553_4

3388134-3388833

TypeI-E

Consensus_repeat	Method
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CRISPRCasFinder
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CRT
GGTCGATCCCCGCGTGGGCGGGG---GAGCC	PILER-CR

11 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of CP029553_4

>merge|CP029553|4|3388134-3388833|CRISPRCasFinder,CRT,PILER-CR
GGGACGATCCCCGCGTGGGCGGGGGAGCCACCGCAACGCGGATCCTCGACCGGTCCGTGATGGGTCGATCCCCGCATGGGCGGGGGAGCCTCCAGGATCGCGAGGCGCAGCATGGCGCGCGTGGGTCGATCCCCGCGTGGGCGGGGGAGCCATGAAATGCTAACGGTCGGGCGAGTAAGGCGCGGGTCGATCCCCGCGTGGGCGGGGGAGCCCGGTCGGCGTCTCGGGTGCGGAGCACGGGGCGGGGTCGATCCCCGCGTGGGCGGGGGAGCCTTGAAAAGTCCCGGCTTCGCGCCTTTGCCGGCAGGTCGATCCCCGCGTGGGCGGGGGAGCCATACCGATATCGTCCCGCCATCCATCCGAGAAGGGTCGATCCCCGCGTGGGCGGGGGAGCCTGTTCTTATTTCTCCGAAACCATCCAGCTCTAGGGTCGATCCCCGCGTGGGCGGGGGAGCCAGCTTCAGATAGGCCCGGATCTGCGTCCGCCCGGGTCGATCCCCGCGTGGGCGGGGGAGCCCGCCCGCGATGTATGACGGCCCGGTGAGTCCGCGGTCGATCCCCGCGTGGGCGGGGGAGCCCGATGCGTAGGCTGTCCGAGACGCAGCGCGCCGGGTCGATCCCCGCGTGGGCGGGGGAGCCGAGGCGTCGGGCTGGCCCTTGCCCGCGGCCTCGGGTCGATCCCCGCGTGGGCGGGGGAGCC

>CP029553|4|4|3388134-3388833|CRISPRCasFinder
GGGACGATCCCCGCGTGGGCGGGGGAGCC	ACCGCAACGCGGATCCTCGACCGGTCCGTGAT
GGGTCGATCCCCGCATGGGCGGGGGAGCC	TCCAGGATCGCGAGGCGCAGCATGGCGCGCGT
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	ATGAAATGCTAACGGTCGGGCGAGTAAGGCGC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGGTCGGCGTCTCGGGTGCGGAGCACGGGGCG
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	TTGAAAAGTCCCGGCTTCGCGCCTTTGCCGGC
AGGTCGATCCCCGCGTGGGCGGGGGAGCC	ATACCGATATCGTCCCGCCATCCATCCGAGAA
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	TGTTCTTATTTCTCCGAAACCATCCAGCTCTA
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	AGCTTCAGATAGGCCCGGATCTGCGTCCGCCC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGCCCGCGATGTATGACGGCCCGGTGAGTCCG
CGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGATGCGTAGGCTGTCCGAGACGCAGCGCGCC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	GAGGCGTCGGGCTGGCCCTTGCCCGCGGCCTC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC

>CP029553|4|2|3388134-3388833|CRT
GGGACGATCCCCGCGTGGGCGGGGGAGCC	ACCGCAACGCGGATCCTCGACCGGTCCGTGAT
GGGTCGATCCCCGCATGGGCGGGGGAGCC	TCCAGGATCGCGAGGCGCAGCATGGCGCGCGT
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	ATGAAATGCTAACGGTCGGGCGAGTAAGGCGC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGGTCGGCGTCTCGGGTGCGGAGCACGGGGCG
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	TTGAAAAGTCCCGGCTTCGCGCCTTTGCCGGC
AGGTCGATCCCCGCGTGGGCGGGGGAGCC	ATACCGATATCGTCCCGCCATCCATCCGAGAA
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	TGTTCTTATTTCTCCGAAACCATCCAGCTCTA
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	AGCTTCAGATAGGCCCGGATCTGCGTCCGCCC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGCCCGCGATGTATGACGGCCCGGTGAGTCCG
CGGTCGATCCCCGCGTGGGCGGGGGAGCC	CGATGCGTAGGCTGTCCGAGACGCAGCGCGCC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC	GAGGCGTCGGGCTGGCCCTTGCCCGCGGCCTC
GGGTCGATCCCCGCGTGGGCGGGGGAGCC

>CP029553|4|2|3388135-3388833|PILER-CR
GGACGATCCCCGCGTGGGCGGGGGAGCC	ACCGCAACGCGGATCCTCGACCGGTCCGTGATG
GGTCGATCCCCGCATGGGCGGGGGAGCC	TCCAGGATCGCGAGGCGCAGCATGGCGCGCGTG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	ATGAAATGCTAACGGTCGGGCGAGTAAGGCGCG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	CGGTCGGCGTCTCGGGTGCGGAGCACGGGGCGG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	TTGAAAAGTCCCGGCTTCGCGCCTTTGCCGGCA
GGTCGATCCCCGCGTGGGCGGGGGAGCC	ATACCGATATCGTCCCGCCATCCATCCGAGAAG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	TGTTCTTATTTCTCCGAAACCATCCAGCTCTAG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	AGCTTCAGATAGGCCCGGATCTGCGTCCGCCCG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	CGCCCGCGATGTATGACGGCCCGGTGAGTCCGC
GGTCGATCCCCGCGTGGGCGGGGGAGCC	CGATGCGTAGGCTGTCCGAGACGCAGCGCGCCG
GGTCGATCCCCGCGTGGGCGGGGGAGCC	GAGGCGTCGGGCTGGCCCTTGCCCGCGGCCTCG
GGTCGATCCCCGCGTGGGCGGGGGAGCC

Protein	Signature genes	Signature genes Name	Protein_function
CP029553.1\|AWN47546.1\|3377453_3378185_-\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47558.1\|3392779_3393583_-\|hypothetical-protein	cse2gr11	mkCas0196_cse2gr11_CAS-I-E	gnl\|CDD\|187862
CP029553.1\|AWN47555.1\|3390094_3390883_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	cd09727_cas6e_CAS-I-E	gnl\|CDD\|215025
CP029553.1\|AWN47550.1\|3381504_3381753_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47554.1\|3389217_3390090_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|187850
CP029553.1\|AWN47562.1\|3400338_3401598_-\|glycerate-kinase	unknown	unknown	gnl\|CDD\|225254
CP029553.1\|AWN47549.1\|3379864_3380668_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN50079.1\|3383691_3384513_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|131643
CP029553.1\|AWN47553.1\|3388880_3389171_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
CP029553.1\|AWN47552.1\|3386460_3387744_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271177
CP029553.1\|AWN47545.1\|3375170_3377399_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47548.1\|3379498_3379795_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47557.1\|3391610_3392783_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
CP029553.1\|AWN47556.1\|3390879_3391611_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09645_cas5_CAS-I-E	gnl\|CDD\|273842
CP029553.1\|AWN47551.1\|3381749_3382031_+\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47560.1\|3395616_3398259_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
CP029553.1\|AWN50078.1\|3382682_3383708_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379142
CP029553.1\|AWN47559.1\|3393443_3395012_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cls000028_cas8e_CAS-I-E	gnl\|CDD\|274192
CP029553.1\|AWN47561.1\|3398859_3400272_-\|pyruvate-kinase	unknown	unknown	gnl\|CDD\|180487
CP029553.1\|AWN47547.1\|3379130_3379355_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226181

Protein	Function_ID	Function_description	E-value
CP029553.1\|AWN47561.1\|3398859_3400272_-\|pyruvate-kinase	gnl\|CDD\|180487	PRK06247, PRK06247, pyruvate kinase; Provisional.	0
CP029553.1\|AWN47559.1\|3393443_3395012_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|274192	TIGR02547, CRISPR_system_Cascade_subunit_CasA, CRISPR type I-E/ECOLI-associated protein CasA/Cse1. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model family, represented by CT1972 from Chlorobium tepidum, is found in Ecoli subtype CRISPR/Cas regions of many bacteria, most of which are mesophiles, and not in Archaea. It is designated Cse1.	8.37916e-20
CP029553.1\|AWN47555.1\|3390094_3390883_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|215025	smart01101, CRISPR_assoc, This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	1.38643e-26
CP029553.1\|AWN47556.1\|3390879_3391611_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	1.18385e-42
CP029553.1\|AWN47562.1\|3400338_3401598_-\|glycerate-kinase	gnl\|CDD\|225254	COG2379, GckA, Putative glycerate kinase [Carbohydrate transport and metabolism].	0
CP029553.1\|AWN47554.1\|3389217_3390090_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187850	cd09719, Cas1_I-E, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer integration; Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	4.23087e-106
CP029553.1\|AWN50079.1\|3383691_3384513_-\|hypothetical-protein	gnl\|CDD\|131643	TIGR02594, hypothetical_protein, TIGR02594 family protein. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.	1.48951e-08
CP029553.1\|AWN47553.1\|3388880_3389171_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.659e-26
CP029553.1\|AWN47552.1\|3386460_3387744_-\|site-specific-integrase	gnl\|CDD\|271177	cd00796, INT_Rci_Hp1_C, Shufflon-specific DNA recombinase Rci and Bacteriophage Hp1_like integrase, C-terminal catalytic domain. Rci protein is a tyrosine recombinase specifically involved in Shufflon type of DNA rearrangement in bacteria. The shufflon of plasmid R64 consists of four invertible DNA segments which are separated and flanked by seven 19-bp repeat sequences. RCI recombinase facilitates the site-specific recombination between any inverted repeats results in an inversion of the DNA segment(s) either independently or in groups. HP1 integrase promotes site-specific recombination of the HP1 genome into that of Haemophilus influenza. Bacteriophage Hp1_like integrases are tyrosine based site specific recombinases. They belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.45198e-31
CP029553.1\|AWN47547.1\|3379130_3379355_-\|transcriptional-regulator	gnl\|CDD\|226181	COG3655, COG3655, Predicted transcriptional regulator [Transcription].	0.00203942
CP029553.1\|AWN47557.1\|3391610_3392783_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.11693e-112
CP029553.1\|AWN47558.1\|3392779_3393583_-\|hypothetical-protein	gnl\|CDD\|187862	cd09731, Cse2_I-E, CRISPR/Cas system-associated protein Cse2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Small alpha-helical protein; also known as Cse2/CasB/YgcK family; specific gene for I-E subtype;.	4.73281e-08
CP029553.1\|AWN47560.1\|3395616_3398259_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.22139e-84
CP029553.1\|AWN50078.1\|3382682_3383708_-\|hypothetical-protein	gnl\|CDD\|379142	pfam13365, Trypsin_2, Trypsin-like peptidase domain. This family includes trypsin-like peptidase domains.	1.07376e-08

>CP029553.1|AWN47552.1|3386460_3387744_-|site-specific-integrase
MPRHASPFKSRSSRAALPTSDAPTWEMIGPGIRLGYRSGRGTRGQGGSWLAASRGPDGTRVQIRLGKADDAAEADGSSVLTHEQAKEAARAWVKSLRKAPEAEPALTVADALEQYLEARTAEGMKAVYDAHSRARTHILPKLGALRVGDLTLDKLRRWRDAMVHAPKRVRTGRLATKVNTLDVDTTDPEALRRRRDTANRTLTLLKAALNWAYKHQMVADDRAWRLLTPFRDTGSARVRFLDAAEQQRLLNTCEGSLRDLVAAALMTGARFGELARLTVRDFDQANGTVFIEHSKNGRARHIPLTPGGAALFGRLVIGRVPKAPLLIRENGEPWRPMTYQRGFKAALARAKLESITLHELRHSYASAMVRNGAPLIVVAEALGHSGTRMAEKHYAHLAPSYVADTIRRTAPDLSLPAENAVRLGIAG
>CP029553.1|AWN50079.1|3383691_3384513_-|hypothetical-protein
MDRRNLILGSTFLFTAGRIPSVRANDDATDIKIIGAVPPLPSDLAGNADQPPAIYSATRPVGAAPPSTDEIDHAYDILVSSPFGVAPIDIAQYFLAVGSGAYGAESQPYAREWPVRANPLIFHFFSATQTSPEGDTTAWCAAFVNWCLARSKASSRDEIGSSPGAFSQNGKPFKVETLRDHTTNNASSGSFRCWDSVAYPKRGDIAVFKDPGTDSLTAACRGSGHVAFVLGTSNGLVRVLGGNQSQKGCNGAVTVADMKTSTGSRFMKYVNVR
>CP029553.1|AWN50078.1|3382682_3383708_-|hypothetical-protein
MLTCDEAVKMQRRGIICLLFFSYLSTASDAFGSDVDDLIRSTYRNSVLKVKVSNNLPVFNDKNENICRSEGTGFLISSNYAITAAHVFKLNNKCLNPIITVNSRLPGSLRLAEIIDSYNDVALLKIKEPLPSRFCALRVLSSDVYASKGLRFGIPHDLQDAMAVPIDIGEKDNEFAPSVVLTPPFTEPGESGGPVIYQFNVVGMTRAKSETHPGYSFMEAAGNIRFLMRKNGVKNDGKTCNPAELFMFDAEAGGSGVGLQVTDGVSERLSSKIIEDAASALAQSAASDPNNKDLIISKTADTLFIQRGTANKSELDPSKIEQTITPQVEKSIWDDYLNQNR
>CP029553.1|AWN47551.1|3381749_3382031_+|hypothetical-protein
MTNVIPFPRTAAGISATRIPRAEFERLAELALDVVDRIILLLDEADGDAEAEDGGDCEPSLGAPEGHASQIIWLRGGDDDREHDTAPIATWSE
>CP029553.1|AWN47550.1|3381504_3381753_+|hypothetical-protein
MSIGELSALLSVYEQAARAFTRNVFWPELGPHGFCRVDDEAERCASIQRAILDEFGSRSSASDADQADITDPAEASNGRRHQ
>CP029553.1|AWN47549.1|3379864_3380668_+|hypothetical-protein
MVSMTLALLTALPARRAIGAGAAALLAAPVKAQVAPSTRVHALALPAPVAVADPILSAIRAHRRAWAAFQVAPDEEASEAEEAEYEAAQALLGVTCSTRPGAHALIAHLRWYVAEEVDNLLTAGLGGCHLGSQLKARLAELVMFVPEASPPAVIALPAPRGPSPLLAAIETYRSANLAVTQAVADYVRAEQDSAPDEPLMLAIADRASDEEVAALNALLALTPANAEEVRTLATYLAEVSTDFDKGAFGAWLFQRFAVMLANAAAQA
>CP029553.1|AWN47548.1|3379498_3379795_+|hypothetical-protein
MAATRQIDWTAAMHAVAADRAKRPAGLLAARSLIAATSAKRRPLVVAGAYDRAAIMSAAIAAARIHQGRTDSTWGEALSVTLKATWQLAKAARTAKAH
>CP029553.1|AWN47547.1|3379130_3379355_-|transcriptional-regulator
MAKAALGWSNPTLAEKTGLHRNTLNRAENGEAKRSTLELLRRVFEEAGLEFIPENGGGAGIRFRNRSDGTREEH
>CP029553.1|AWN47546.1|3377453_3378185_-|hypothetical-protein
MSDEKPERIPAFPMDDKRSAAYHVAMGTLDAAASVVPGGSYGVQQIVRQFIGEPLERRREAWFAAVGDSLREMQDRFDGFDPANLADDEEFLSAVAEASRIAMTTHRAEKLDALRNAVLNAAAGIHLDEVLQKTFLGYVDRFSTLHFQVLKLLANPAANPKAAARAEGMMTGSLGQIIHAALPETTGNPVLLGRVLGELEREGLTNGASMNTMMTATGVTEKRTSEFGDTFLSFISNPASKVA
>CP029553.1|AWN47545.1|3375170_3377399_+|hypothetical-protein
MADAFDLADFERFKSRNLLPRAGGRGGPPVAVGNPFERPAAEFDPDDFAKFKAEATARAAPIGGGEAFLRGAEQGATFGFGDEARGLLAASPMRQQIDAGPGDGSIGDRLRQVAAWNLRNGPLGLIAQGAEGAARYLRAEAGATEAYDAAVAANRQDLVRAREQHPYLTGGGEVAGGVAATLPLMAAAPAAFGVGGSTIGRQMAMAGGSGVALGGLTGFGQGEGESIDRAVNAGWGAAAGAVGGAAGVPAGAALSRAVRGAASLLPERVSGLSARTTKEAARALTEAGPDAVQARLAELGPGGMLLDAAQPFLGRAQGLAANPGAPGEKVVSTLRARDAGTDARLARGLEEAVGPAPVPSQVEAQFVDKRAAAGPLYERALTHEGAIDTTEALTEIGQRLNTAAGAERAALLRARDLLTQQTDRGLVPRSDARYLHNAKGALDELIDFGDQTIGVPRGALSKEDGALARVRGRLNGALEAQVPGYADANLAYRTAARASEALESGQRVLGGGDRAIHPADFAADLVGRPIEQQAALRAGVRADLDRTVGNAANDLTALSGELKRPADWNRQKLETTFGRDAVDALAVTIDANAAMRQSFNDVARGSQTAQRSRGADAMSVRDLIPSGKDAGLTAVAAAIGGWPAAAAPAALRGARIGLNAVGRASDRARNAEFADILTRQGADRDVLVSQLVALLEGRATRGIVPGSYADALARQGAGSLGRERDVVALPRGVLPFGALRVP
>CP029553.1|AWN47553.1|3388880_3389171_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MPMTVVVTRDVADRFRGFLSSVMPEAAPGVFVAAELSRGVRERVWTVLSEWWADMPGGSIVILWKDDAAPGRLGLRTLGLPPRTLADLDGALLVRR
>CP029553.1|AWN47554.1|3389217_3390090_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MLKGRLGLETARQPHADRHGLVWLDRGALTVEDGCLRFVAAGSETVEAGDYRIPHQALSMVLLGPGSTVSHDALRILARHNTALAAIGEGGVRFYTAQPLLPDTSALARRQATAWADAKGGRMKVARRMYALRLGEVLPHRDIAVLRGIEGARVKEIYRQAAERHGIRWQGRRYDRQNPNAADIPNQALNHAASAVEGAAAIAVAATATIPQLGFIHEDSGQSFVLDVADLFRDTITVPCAFKAAKAHEKRPTDPIERLARRTVAERLRRDGVIPAMIDRIKTLFEEETP
>CP029553.1|AWN47555.1|3390094_3390883_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTLILLQMRPALGPLLRWAERRKLVAAHGPDDLGYALHAILAAAFGEHAPKPFVLLDPPRRRERPGADPAPQLLGYTTRDAAALRAHAAAFAEPEVAEALGLDGLAAKAMPERFPAGTRLGFRTRIRPTVRRDRDGDRTRTREKDAYLAALDPYEGQPAPFGRGEVYRDWLARHLAAGGAELEGASLDAFRLTRSLRRGRERHLAQIPLPSQKMKGAAGHPDATVTGVLIVRDPEAFAALLARGIGRHRAFGFGMLLLRPPE
>CP029553.1|AWN47556.1|3390879_3391611_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MPHFLLLRLEAPLLAFGGEVVDARGVLVDFPGASLLTGLLANALGYRRGEADRLQALQDRLVYAARLDRTAARITDFQTAQLDKDDRGWTTRGRPEGRAGGAGSYVGPHLRRRDYDCDVSCAVALRLEQPEAAPTLGDLVAKLLHPARPLFLGRKPCLPSRPLLEPESELRIVEADDLVAALSLLPPAEDSDPTLRVLLPESEPAAPGDHVRPVTDARNWRSGVHGGHRLVRVRAVKRPGAAA
>CP029553.1|AWN47557.1|3391610_3392783_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTRFLQIHSLASYPAVLLNRDDAGLAKRLPYGGSVRTRVSSQSLKRHWRLAEDAWALSKVGAPMGVRSREIVERRVLDKITAAPAIVEAVGAALVKHLYGKNSAKIADRQALLLGEPEIAYLARIGAEAAAAATDAKSAEAEIDARLAKGTGKANLAAMLASAGTLAAGLEAALFGRMVTSDPDANTDAAIHVAHAFTVHAQESESDYFTVVDDLRVAAGEVGSGGIFDTELTSGLYYGYVVVDVPLLVSNLAGDPDLAAKVVEHLVHLIATVSPGAKKGSTAPYAYADLMLVEAGSRQPRTLAGAFRKAVPLRRDGDLAAEAVAAMAACLTRLDRAYGQEEERANLSVVESSDLSLGASGFGGQMTLDGLAAWAAEQVRAGQASAGKGK
>CP029553.1|AWN47558.1|3392779_3393583_-|hypothetical-protein
MPACRRPWGGAGAHWSGPRPCSGPARATRNPICRNSSRSRSVTTQPDPAGGDPPPRHRAEIAARIAAPLTNEDRFGTGPLAELRRLDPNGALAEPTLHRLLARHTTEREVGETGFPAWALVIHAAALAAPDHLSFPRREDEPAENGAEARAAFWAERSRRAQRQFGRDLFEAGVSERRFSILLDATADELRIVMPRIVRLLVGAGKRLPVLAVADLVASARHLEDPWAQSVRHRIARGYYRAEAGPKPDARPGSETAPSSSSPGETA
>CP029553.1|AWN47559.1|3393443_3395012_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MSIKNLILNKAIRVILDGNRAVSTLPSVFAALARNAISSFPALRPHQRHAWHAFLVQLGALALLRAGREAMPEDEETWRDLLRGLTADFPGDEPWCLVAPPDRPALLQPPIPGGLKDLKNAVPTPDALDMLVTSKNHDLKSEVMMAAEPDDWLFALVALQTSEGFLGAGNYGISRMNGGFANRPAFSVVPTTGPVSPVRRDVEALVALRKTEGASTVYAAEGGLGLVWLRPWDGATALPPSELDPLHIEICRRVRLVEEGGRIAARAGGSKVARIVPIPGGAPGDPWAPTVTDKDGPRILTVDAGGFHYRRIVRLLFEREGHALPVLAATLPTDAEEGLVVLARALTRGQGKTEGWHERRLPISRTVYRALRTRATDAIGRAATERVALAGEIQNRVLKPALLALFQNGPDQVDYQDKGANARARDLLARFDRAVDATFFEDLWAEVEPDADPDAVRTAWVRRLVNGVAWPLVVEADAGLSKAVGRRWRALVRAEAVFRAGTRNPKSDLPKFFPEPKRDDAA
>CP029553.1|AWN47560.1|3395616_3398259_-|CRISPR-associated-helicase/endonuclease-Cas3
MTAFSQDDLWAKRDAAGRWHSLVGHSADVGAVLAALLDLPTIGERLRRFGRTDAAAASSISAKLSALAFLHDVGKANRGFQARSDANAPRVGHIDELAWVFSPRRGADAVCDRLSERLGLDRVAAWLPEDEPDLFHAVFAHHGRPWALGHEGSQADVRDASAQWRGGPGDPVARLGPMRAALDAWFGDALADGSPLPDQPAVAHAFAGLLMLADWLGSNPGPGFFPFDEGRHADRMAFARERAADVLTATGLDAQPAREAARRVGAGFPHAFAQAGRPPFAARPIQAEAARHPAQLLVLEAETGSGKTEAALWRFIELFRAGAVDGLYFALPTRVAATQIFERVKRFRDNVFPPDWRPAVVLAVPGQMRVDEAEGARLPDFDVQWNDDGDRAARWAAEHPKRYLAAPIAVGTIDQALLGAVRVKHAHLRAVSLLGKLLVIDEVHASDAYMERLLANLLRFHVGAGGHALLLSATLGAGARARLLGAATVPDRAAADAVDYPALSWCEDGVERRQPLGAAGEGKAVRLEARPILADPDAVAASSLAAARAGAKVLIVRNTVGQALRTQEALEALATRADGATLFRVPHADGRGIATLHHSRFAEPDRRLLDAAVEAAIGREREAGGRIVVGTQTLEQSLDLDADLLLTDLCPVDVLLQRIGRLHRHAGRPRPAGYAAPRAVVLVPEGRELFRADLRAYGLGSGETGGVYEDLRILELTRRLVEAEPVWTIPAMNRRLVEAATHPDALAAIEAELTAADPAWRPHFDRRTGRYFADLNAAQGALLRFDRPFTAFRIEPDEIIATRIGGADRHVAFDVEGQPLPTGPFGRPVPSLKLPHHVAANISVDAQPDLVETLGDGDGFTFRLGPSVFTYDRFGLRRNA
>CP029553.1|AWN47561.1|3398859_3400272_-|pyruvate-kinase
MRRHRHAKIVATVGPASSAPDRLRALFLAGVDTFRLNFSHGTHDDHARVHAAIRALEAEVGRPIGILQDLQGPKIRIGTVKDGRLDLEAGESVRFVLEGGEGDARAIPLHHPEIFSAIVPGQDLLIDDGRVRVRVTGLDAASLTAEVVTGGALTDRKGVNLPGTLLDLSPLTRKDRADLAFGLELGVDWVALSFVQKPSDMVEARALIGDRAGLLAKIEKPQALERIEDIIRLSDAVMVARGDLGVEIPHEDVPGRQKELIRACRLAVKPVIVATQMLDSMVGAPAPTRAEASDVATAIYDGADAVMLSAESATGKYPVEAVAMMDRIIRSVEGHKLYHSIVAASDPGEEETPPHAVASATATLAEALHAKAIVTYTASGTTAARVARKRPEPPTLALTPNLATARRLCLLWGAHSVQTEDVNSYEEMVAKAAHHARAEGFARSNDHIVIAAGIPFHTTGNTNNIRLLQI
>CP029553.1|AWN47562.1|3400338_3401598_-|glycerate-kinase
MTEPGDLLRRLFAAAVAAADPAISLARHLPEPPRGRTIVVGAGKAAASMARAVEAAWPGEISGLVVTRYGHGAPTTRIAVVEASHPVPDAAGEAASKAILAAVAGLTPDDLVLCLISGGGSALLSLPAPGLTLSDKQAVNRALLTSGAAIGEMNCVRRHLSAIKGGRLAAACHPARLVTLLISDTPGDDPLDIASGPTVADPTTCADALAILDRYRIEVPEAVRRHLASGRGESIKPGDPLLGLPDLRMVATPLMALEAAADLARREGITPLILGDAIEGEAREVGKVMAGIARSVAAHGLPVPKPCILLSGGETTVTVRGPGRGGRNVEFLLALGAALDGHPGIHAIAGDTDGVDGLEEIAGAVLGPDTGARATALGLSLAASLDRNDGHGFFEALGDGVVTGPTLTNVNDFRAILIA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: CP029553_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP029553_5

3647487-3649357

Orphan

A:N

Consensus_repeat	Method
GGCTC---CCCCGCCTACGCGGGGATCGACC	PILER-CR
GGCTCCCCCGCCTACGCGGGGATCGACCC	CRISPRCasFinder
GGCTCCCCCGCCTACGCGGGGATCGACCC	CRT
CTC---CCCCGCCTACGCGGGGATCGACCC	PILER-CR

30 spacers

The CRISPR arrays of CP029553_5

>merge|CP029553|5|3647487-3649357|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
GGCTCCCCCGCCTACGCGGGGATCGACCCGAGACGGGACAGGCACAGACCCGGTCGGGCCGGGCTCCCCCGCCTACGCGGGGATCGACCCCGATCCCGCGGGTAGGGCGGGAAGGCGGCCCCGGCTCCCCCGCCTACGCGGGGATCGACCCCCGACCTCGACCAGCTGGGACCTCGTCTCGAAGGCTCCCCCGCCTACGCGGGGATCGACCGTAGACCCAACGCCGGTGCCCCTCGGCCTCGAGGGCTCCCCCGCCTACGCGGGGATCGACCGTCGGGCCCGGGGAGAGGGCCGAAGCCGAAGGAGGCTCCCCCGCCTACGCGGGGATCGACCCCCGAAGCCGCACGAGGGACACTAATGACTGAAGGCTCCCCCGCCTACGCGGGGATCGACCCGTGTAGCTGTCGTCCTTCGCCGCCTTGGCGACGGCTCCCCCGCCTACGCGGGGATCGACCCTCGGCGGCTATCGCGTGCTGCTGACCTGGATCGGCTCCCCCGCCTACGCGGGGATCGACCCTCGCTGGCCTCGGGCGCTTCGAAGTCGAAGTAGGCTCCCCCGCCTACGCGGGGATCGACCCGTGTCGGCCCTGACGACGCTCGGCGCCACCCGGGCTCCCCCGCCTACGCGGGGATCGACCCCCCTCGTCGAAGCTGACCGACCGGCAAGTCGCGGCTCCCCCGCCTACGCGGGGATCGACCCGATCCTAAGGCCGAACCTTGGGCCGACGAGCCGGCTCCCCCGCCTACGCGGGGATCGACCCGTGCGGTCAAGTTGCGTGCGTAGACGCGATCCGGCTCCCCCGCCTACGCGGGGATCGACCCTGGCCGACCTCTTCGAGCGTGCCCGTGCCGTCGGCTCCCCCGCCTACGCGGGGATCGACCCCTCGCGACGCTCACGGCCTTCGGGGCGACCCGGGCTCCCCCGCCTACGCGGGGATCGACCCCAGGTCTCGGCGATCGCGTCGGTCCCGACCGCGGCTCCCCCGCCTACGCGGGGATCGACCTTCAGACGCCGGCATCACGCCCCCGTCTCGTCCTCGCAAGCGACGGCTCCCCCGCCTACGCGGGGATCGACCGGCTTCGGGTTCTCTAGCGGCGAGCACATGGTCGGCTCCCCCGCCTACGCGGGGATCGACCCCAGCATCCAGTTTCCAGAGCGCTTGAGTTTCCGGCTCCCCCGCCTACGCGGGGATCGACCTTTTCTTATTCATCCGTATGGCGGGGCGTCGAAGGCTCCCCCGCCTACGCGGGGATCGACCCCCTCCGACCACGCCGATGATGCCGCCAAGCCAGGCTCCCCCGCCTACGCGGGGATCGACCCCACGCATCCAGGCCGGCGACGCCGGAGCGGAAGGCTCCCCCGCCTTTGCGGGGATCGACCCTGCCTGCCGCGGGCCGACGGCTACGGCCCGTTGGCTCCCCCGCCTACGCGGGGATCGACCCCGATAGGTGTCCTGGTCCTCGATCAGCGTGTCGGCTCCCCCGCCTACGCGGGGATCGACCTGCGTGGCTCGGCCAGACGCTCGACATGCTTAAGGCTCCCCCGCCTACGCGGGGATCGACCCCCGCCGCGCACTTCCAGTTGATGGAGTTCGCGGGCTCCCCCGCCTACGCGGGGATCGACCCTCGGACAGGGGTGCGACCTGAGCTGCGGAGTGGGCTCCCCCGCCTACGCGGGGATCGACCCGCCGTGTTCTTCGCGGTGTCCACCTGGATCTAGGCTCCCCCGCCTACGCGGGGATCGACCCCCGGTTTGCCGCCGCGATCGCTTCGACGAAGGGGCTCCCCCCGCCTACGCGGGGATCGACCCCGGGGAAATTTGACGGCCAGGGTTAATCCGTGGGCTCCCCCGCCTACGCGGGGATCCCTGC

>CP029553|5|3|3647487-3648745|PILER-CR
GGCTCCCCCGCCTACGCGGGGATCGACC	CGAGACGGGACAGGCACAGACCCGGTCGGGCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCGATCCCGCGGGTAGGGCGGGAAGGCGGCCCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCGACCTCGACCAGCTGGGACCTCGTCTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACC	GTAGACCCAACGCCGGTGCCCCTCGGCCTCGAG
GGCTCCCCCGCCTACGCGGGGATCGACC	GTCGGGCCCGGGGAGAGGGCCGAAGCCGAAGGA
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCGAAGCCGCACGAGGGACACTAATGACTGAA
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGTAGCTGTCGTCCTTCGCCGCCTTGGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTCGGCGGCTATCGCGTGCTGCTGACCTGGATC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTCGCTGGCCTCGGGCGCTTCGAAGTCGAAGTA
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGTCGGCCCTGACGACGCTCGGCGCCACCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCCTCGTCGAAGCTGACCGACCGGCAAGTCGC
GGCTCCCCCGCCTACGCGGGGATCGACC	CGATCCTAAGGCCGAACCTTGGGCCGACGAGCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGCGGTCAAGTTGCGTGCGTAGACGCGATCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTGGCCGACCTCTTCGAGCGTGCCCGTGCCGTC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCTCGCGACGCTCACGGCCTTCGGGGCGACCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCAGGTCTCGGCGATCGCGTCGGTCCCGACCGC
GGCTCCCCCGCCTACGCGGGGATCGACC	TTCAGACGCCGGCATCACGCCCCCGTCTCGTCCTCGCAAGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACC	GGCTTCGGGTTCTCTAGCGGCGAGCACATGGTC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCAGCATCCAGTTTCCAGAGCGCTTGAGTTTCC
GGCTCCCCCGCCTACGCGGGGATCGACC	TTTTCTTATTCATCCGTATGGCGGGGCGTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCCCCTCCGACCACGCCGATGATGCCGCCAAGCCAGGCTCCCCCGCCTACGCGGGGATCGACCCCACGCATCCAGGCCGGCGACGCCGGAGCGGAAGGCTCCCCCGCCTTTGCGGGGATCGACCCTGCCTGCCGCGGGCCGACGGCTACGGCCCGTTGGCTCCCCCGCCTACGCGGGGATCGACCC	CGATAGGTGTCCTGGTCCTCGATCAGCGTGTCGG
CTCCCCCGCCTACGCGGGGATCGACCT	GCGTGGCTCGGCCAGACGCTCGACATGCTTAAGG
CTCCCCCGCCTACGCGGGGATCGACCC	CCGCCGCGCACTTCCAGTTGATGGAGTTCGCGGG
CTCCCCCGCCTACGCGGGGATCGACCC	TCGGACAGGGGTGCGACCTGAGCTGCGGAGTGGG
CTCCCCCGCCTACGCGGGGATCGACCC	GCCGTGTTCTTCGCGGTGTCCACCTGGATCTAGG
CTCCCCCGCCTACGCGGGGATCGACCC	CCGGTTTGCCGCCGCGATCGCTTCGACGAAGGGGC


>CP029553|5|5|3647487-3649357|CRISPRCasFinder
GGCTCCCCCGCCTACGCGGGGATCGACCC	GAGACGGGACAGGCACAGACCCGGTCGGGCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CGATCCCGCGGGTAGGGCGGGAAGGCGGCCCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGACCTCGACCAGCTGGGACCTCGTCTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCG	TAGACCCAACGCCGGTGCCCCTCGGCCTCGAG
GGCTCCCCCGCCTACGCGGGGATCGACCG	TCGGGCCCGGGGAGAGGGCCGAAGCCGAAGGA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGAAGCCGCACGAGGGACACTAATGACTGAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGTAGCTGTCGTCCTTCGCCGCCTTGGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGGCGGCTATCGCGTGCTGCTGACCTGGATC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGCTGGCCTCGGGCGCTTCGAAGTCGAAGTA
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGTCGGCCCTGACGACGCTCGGCGCCACCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCCTCGTCGAAGCTGACCGACCGGCAAGTCGC
GGCTCCCCCGCCTACGCGGGGATCGACCC	GATCCTAAGGCCGAACCTTGGGCCGACGAGCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGCGGTCAAGTTGCGTGCGTAGACGCGATCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TGGCCGACCTCTTCGAGCGTGCCCGTGCCGTC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CTCGCGACGCTCACGGCCTTCGGGGCGACCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CAGGTCTCGGCGATCGCGTCGGTCCCGACCGC
GGCTCCCCCGCCTACGCGGGGATCGACCT	TCAGACGCCGGCATCACGCCCCCGTCTCGTCCTCGCAAGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACCG	GCTTCGGGTTCTCTAGCGGCGAGCACATGGTC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CAGCATCCAGTTTCCAGAGCGCTTGAGTTTCC
GGCTCCCCCGCCTACGCGGGGATCGACCT	TTTCTTATTCATCCGTATGGCGGGGCGTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCTCCGACCACGCCGATGATGCCGCCAAGCCA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CACGCATCCAGGCCGGCGACGCCGGAGCGGAA
GGCTCCCCCGCCTTTGCGGGGATCGACCC	TGCCTGCCGCGGGCCGACGGCTACGGCCCGTT
GGCTCCCCCGCCTACGCGGGGATCGACCC	CGATAGGTGTCCTGGTCCTCGATCAGCGTGTC
GGCTCCCCCGCCTACGCGGGGATCGACCT	GCGTGGCTCGGCCAGACGCTCGACATGCTTAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGCCGCGCACTTCCAGTTGATGGAGTTCGCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGGACAGGGGTGCGACCTGAGCTGCGGAGTG
GGCTCCCCCGCCTACGCGGGGATCGACCC	GCCGTGTTCTTCGCGGTGTCCACCTGGATCTA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGGTTTGCCGCCGCGATCGCTTCGACGAAGGG
GCTCCCCCCGCCTACGCGGGGATCGACCC	CGGGGAAATTTGACGGCCAGGGTTAATCCGTG
GGCTCCCCCGCCTACGCGGGGATCCCTGC

>CP029553|5|3|3647487-3649357|CRT
GGCTCCCCCGCCTACGCGGGGATCGACCC	GAGACGGGACAGGCACAGACCCGGTCGGGCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CGATCCCGCGGGTAGGGCGGGAAGGCGGCCCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGACCTCGACCAGCTGGGACCTCGTCTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCG	TAGACCCAACGCCGGTGCCCCTCGGCCTCGAG
GGCTCCCCCGCCTACGCGGGGATCGACCG	TCGGGCCCGGGGAGAGGGCCGAAGCCGAAGGA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGAAGCCGCACGAGGGACACTAATGACTGAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGTAGCTGTCGTCCTTCGCCGCCTTGGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGGCGGCTATCGCGTGCTGCTGACCTGGATC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGCTGGCCTCGGGCGCTTCGAAGTCGAAGTA
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGTCGGCCCTGACGACGCTCGGCGCCACCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCCTCGTCGAAGCTGACCGACCGGCAAGTCGC
GGCTCCCCCGCCTACGCGGGGATCGACCC	GATCCTAAGGCCGAACCTTGGGCCGACGAGCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	GTGCGGTCAAGTTGCGTGCGTAGACGCGATCC
GGCTCCCCCGCCTACGCGGGGATCGACCC	TGGCCGACCTCTTCGAGCGTGCCCGTGCCGTC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CTCGCGACGCTCACGGCCTTCGGGGCGACCCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	CAGGTCTCGGCGATCGCGTCGGTCCCGACCGC
GGCTCCCCCGCCTACGCGGGGATCGACCT	TCAGACGCCGGCATCACGCCCCCGTCTCGTCCTCGCAAGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACCG	GCTTCGGGTTCTCTAGCGGCGAGCACATGGTC
GGCTCCCCCGCCTACGCGGGGATCGACCC	CAGCATCCAGTTTCCAGAGCGCTTGAGTTTCC
GGCTCCCCCGCCTACGCGGGGATCGACCT	TTTCTTATTCATCCGTATGGCGGGGCGTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCTCCGACCACGCCGATGATGCCGCCAAGCCA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CACGCATCCAGGCCGGCGACGCCGGAGCGGAA
GGCTCCCCCGCCTTTGCGGGGATCGACCC	TGCCTGCCGCGGGCCGACGGCTACGGCCCGTT
GGCTCCCCCGCCTACGCGGGGATCGACCC	CGATAGGTGTCCTGGTCCTCGATCAGCGTGTC
GGCTCCCCCGCCTACGCGGGGATCGACCT	GCGTGGCTCGGCCAGACGCTCGACATGCTTAA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGCCGCGCACTTCCAGTTGATGGAGTTCGCG
GGCTCCCCCGCCTACGCGGGGATCGACCC	TCGGACAGGGGTGCGACCTGAGCTGCGGAGTG
GGCTCCCCCGCCTACGCGGGGATCGACCC	GCCGTGTTCTTCGCGGTGTCCACCTGGATCTA
GGCTCCCCCGCCTACGCGGGGATCGACCC	CCGGTTTGCCGCCGCGATCGCTTCGACGAAGGG
GCTCCCCCCGCCTACGCGGGGATCGACCC	CGGGGAAATTTGACGGCCAGGGTTAATCCGTG
GGCTCCCCCGCCTACGCGGGGATCCCTGC

>CP029553|5|4|3648903-3649296|PILER-CR
	CGAGACGGGACAGGCACAGACCCGGTCGGGCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCGATCCCGCGGGTAGGGCGGGAAGGCGGCCCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCGACCTCGACCAGCTGGGACCTCGTCTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACC	GTAGACCCAACGCCGGTGCCCCTCGGCCTCGAG
GGCTCCCCCGCCTACGCGGGGATCGACC	GTCGGGCCCGGGGAGAGGGCCGAAGCCGAAGGA
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCGAAGCCGCACGAGGGACACTAATGACTGAA
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGTAGCTGTCGTCCTTCGCCGCCTTGGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTCGGCGGCTATCGCGTGCTGCTGACCTGGATC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTCGCTGGCCTCGGGCGCTTCGAAGTCGAAGTA
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGTCGGCCCTGACGACGCTCGGCGCCACCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCCCTCGTCGAAGCTGACCGACCGGCAAGTCGC
GGCTCCCCCGCCTACGCGGGGATCGACC	CGATCCTAAGGCCGAACCTTGGGCCGACGAGCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CGTGCGGTCAAGTTGCGTGCGTAGACGCGATCC
GGCTCCCCCGCCTACGCGGGGATCGACC	CTGGCCGACCTCTTCGAGCGTGCCCGTGCCGTC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCTCGCGACGCTCACGGCCTTCGGGGCGACCCG
GGCTCCCCCGCCTACGCGGGGATCGACC	CCAGGTCTCGGCGATCGCGTCGGTCCCGACCGC
GGCTCCCCCGCCTACGCGGGGATCGACC	TTCAGACGCCGGCATCACGCCCCCGTCTCGTCCTCGCAAGCGAC
GGCTCCCCCGCCTACGCGGGGATCGACC	GGCTTCGGGTTCTCTAGCGGCGAGCACATGGTC
GGCTCCCCCGCCTACGCGGGGATCGACC	CCAGCATCCAGTTTCCAGAGCGCTTGAGTTTCC
GGCTCCCCCGCCTACGCGGGGATCGACC	TTTTCTTATTCATCCGTATGGCGGGGCGTCGAA
GGCTCCCCCGCCTACGCGGGGATCGACCCCCTCCGACCACGCCGATGATGCCGCCAAGCCAGGCTCCCCCGCCTACGCGGGGATCGACCCCACGCATCCAGGCCGGCGACGCCGGAGCGGAAGGCTCCCCCGCCTTTGCGGGGATCGACCCTGCCTGCCGCGGGCCGACGGCTACGGCCCGTTGGCTCCCCCGCCTACGCGGGGATCGACCC	CGATAGGTGTCCTGGTCCTCGATCAGCGTGTCGG
CTCCCCCGCCTACGCGGGGATCGACCT	GCGTGGCTCGGCCAGACGCTCGACATGCTTAAGG
CTCCCCCGCCTACGCGGGGATCGACCC	CCGCCGCGCACTTCCAGTTGATGGAGTTCGCGGG
CTCCCCCGCCTACGCGGGGATCGACCC	TCGGACAGGGGTGCGACCTGAGCTGCGGAGTGGG
CTCCCCCGCCTACGCGGGGATCGACCC	GCCGTGTTCTTCGCGGTGTCCACCTGGATCTAGG
CTCCCCCGCCTACGCGGGGATCGACCC	CCGGTTTGCCGCCGCGATCGCTTCGACGAAGGGGC
TCCCCCCGCCTACGCGGGGATCGACCC

Protein	Signature genes	Signature genes Name	Protein_function
CP029553.1\|AWN47768.1\|3651555_3652530_+\|tetraacyldisaccharide-4'-kinase	unknown	unknown	gnl\|CDD\|234808
CP029553.1\|AWN47763.1\|3644047_3644644_+\|nucleotide-exchange-factor-GrpE	unknown	unknown	gnl\|CDD\|172630
CP029553.1\|AWN47773.1\|3658176_3660507_-\|RNA-degradosome-polyphosphate-kinase	unknown	unknown	gnl\|CDD\|235469
CP029553.1\|AWN47759.1\|3638284_3639067_-\|nitrate/sulfonate/bicarbonate-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213260
CP029553.1\|AWN47767.1\|3650254_3651559_+\|3-deoxy-D-manno-octulosonic-acid-transferase	unknown	unknown	gnl\|CDD\|235589
CP029553.1\|AWN47772.1\|3656575_3658111_-\|exopolyphosphatase	unknown	unknown	gnl\|CDD\|223326
CP029553.1\|AWN47762.1\|3641163_3643989_+\|[protein-PII]-uridylyltransferase	unknown	unknown	gnl\|CDD\|235342
CP029553.1\|AWN47771.1\|3654151_3655465_+\|thymidine-phosphorylase	unknown	unknown	gnl\|CDD\|180276
CP029553.1\|AWN47757.1\|3637235_3637508_-\|hypothetical-protein	unknown	unknown	unknown
CP029553.1\|AWN47774.1\|3660650_3661382_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|169652
CP029553.1\|AWN47770.1\|3653307_3654129_+\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|236183
CP029553.1\|AWN50094.1\|3652912_3653311_+\|cytidine-deaminase	unknown	unknown	gnl\|CDD\|273572
CP029553.1\|AWN47766.1\|3649526_3650258_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|153245
CP029553.1\|AWN47761.1\|3639935_3640934_-\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270274
CP029553.1\|AWN47769.1\|3652515_3652737_-\|DUF2093-domain-containing-protein	unknown	unknown	gnl\|CDD\|226423
CP029553.1\|AWN47756.1\|3636345_3637128_+\|histidine/lysine/arginine/ornithine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226961
CP029553.1\|AWN47760.1\|3639097_3639931_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
CP029553.1\|AWN47764.1\|3644797_3646141_-\|glycolate-oxidase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|236890
CP029553.1\|AWN47765.1\|3646300_3647269_-\|rubrerythrin	unknown	unknown	gnl\|CDD\|153104
CP029553.1\|AWN47758.1\|3637685_3638195_-\|peroxiredoxin	unknown	unknown	gnl\|CDD\|376823

Protein	Function_ID	Function_description	E-value
CP029553.1\|AWN47768.1\|3651555_3652530_+\|tetraacyldisaccharide-4'-kinase	gnl\|CDD\|234808	PRK00652, lpxK, tetraacyldisaccharide 4'-kinase; Reviewed.	1.61364e-101
CP029553.1\|AWN47763.1\|3644047_3644644_+\|nucleotide-exchange-factor-GrpE	gnl\|CDD\|172630	PRK14141, PRK14141, heat shock protein GrpE; Provisional.	7.59851e-92
CP029553.1\|AWN47773.1\|3658176_3660507_-\|RNA-degradosome-polyphosphate-kinase	gnl\|CDD\|235469	PRK05443, PRK05443, polyphosphate kinase; Provisional.	0
CP029553.1\|AWN47759.1\|3638284_3639067_-\|nitrate/sulfonate/bicarbonate-ABC-transporter-ATP-binding-protein	gnl\|CDD\|213260	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters. NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.	1.65502e-110
CP029553.1\|AWN47767.1\|3650254_3651559_+\|3-deoxy-D-manno-octulosonic-acid-transferase	gnl\|CDD\|235589	PRK05749, PRK05749, 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed.	7.98446e-156
CP029553.1\|AWN47772.1\|3656575_3658111_-\|exopolyphosphatase	gnl\|CDD\|223326	COG0248, GppA, Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism].	1.21774e-117
CP029553.1\|AWN47762.1\|3641163_3643989_+\|[protein-PII]-uridylyltransferase	gnl\|CDD\|235342	PRK05092, PRK05092, PII uridylyl-transferase; Provisional.	0
CP029553.1\|AWN47771.1\|3654151_3655465_+\|thymidine-phosphorylase	gnl\|CDD\|180276	PRK05820, deoA, thymidine phosphorylase; Reviewed.	0
CP029553.1\|AWN47774.1\|3660650_3661382_-\|hypothetical-protein	gnl\|CDD\|169652	PRK09087, PRK09087, hypothetical protein; Validated.	1.06062e-62
CP029553.1\|AWN47770.1\|3653307_3654129_+\|purine-nucleoside-phosphorylase	gnl\|CDD\|236183	PRK08202, PRK08202, purine nucleoside phosphorylase; Provisional.	8.72704e-132
CP029553.1\|AWN50094.1\|3652912_3653311_+\|cytidine-deaminase	gnl\|CDD\|273572	TIGR01354, Cytidine_deaminase, cytidine deaminase, homotetrameric. This small, homotetrameric zinc metalloprotein is found in humans and most bacteria. A related, homodimeric form with a much larger subunit is found in E. coli and in Arabidopsis. Both types may act on deoxycytidine as well as cytidine. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides].	4.20802e-54
CP029553.1\|AWN47766.1\|3649526_3650258_+\|hypothetical-protein	gnl\|CDD\|153245	cd07983, LPLAT_DUF374-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are the uncharacterized DUF374 phospholipid/glycerol acyltransferases and similar proteins.	7.80475e-59
CP029553.1\|AWN47761.1\|3639935_3640934_-\|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270274	cd13556, PBP2_SsuA_like_1, Substrate binding domain of putative sulfonate binding protein, a member of the type 2 periplasmic binding fold superfamily. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.33194e-136
CP029553.1\|AWN47769.1\|3652515_3652737_-\|DUF2093-domain-containing-protein	gnl\|CDD\|226423	COG3908, COG3908, Uncharacterized protein conserved in bacteria [Function unknown].	1.5243e-25
CP029553.1\|AWN47756.1\|3636345_3637128_+\|histidine/lysine/arginine/ornithine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226961	COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism].	3.99277e-143
CP029553.1\|AWN47760.1\|3639097_3639931_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	4.6634e-65
CP029553.1\|AWN47764.1\|3644797_3646141_-\|glycolate-oxidase-iron-sulfur-subunit	gnl\|CDD\|236890	PRK11274, glcF, glycolate oxidase subunit GlcF.	5.00681e-162
CP029553.1\|AWN47765.1\|3646300_3647269_-\|rubrerythrin	gnl\|CDD\|153104	cd01045, Ferritin_like_AB, Uncharacterized family of ferritin-like proteins found in archaea and bacteria. Ferritin-like domain found in archaea and bacteria (Ferritin_like_AB). This uncharacterized domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins whose function is unknown. This family includes unknown or hypothetical proteins which were sequenced from mostly anaerobic or microaerophilic metal-metabolizing and/or nitrogen-fixing microbes. The family includes sequences from ferric-, sulfate-, and arsenic-reducing bacteria, Geobacter, Magnetospirillum, Desulfovibrio, and Desulfitobacterium. Also included are several nitrogen-fixing endosymbiotic bacteria, Rhizobium, Mesorhizobium, and Bradyrhizobium; also phototrophic purple nonsulfur bacteria, Rhodobacter and Rhodopseudomonas, as well as, obligate thermophiles, Thermotoga, Thermoanaerobacter, and Pyrococcus. The conserved residues of a diiron center are present in this uncharacterized domain.	1.09854e-31
CP029553.1\|AWN47758.1\|3637685_3638195_-\|peroxiredoxin	gnl\|CDD\|376823	pfam02566, OsmC, OsmC-like protein. Osmotically inducible protein C (OsmC) is a stress -induced protein found in E. Coli. This family also contains a organic hydroperoxide detoxification protein that has a novel pattern of oxidative stress regulation.	7.39143e-15

>CP029553.1|AWN47765.1|3646300_3647269_-|rubrerythrin
MMALTDLTEREVLALAIASEEEDSRIYRSFAESLRADLPGSAGLFEAMADEERGHRDDLYAAYRQRFGEHLPPLRREDVRGFPRRRAVWWQGLDAGRMRREAEAMEAQAAGFYERAAELSRDLGVRQLFTRLAEIERGHGRRAGALAAAQETGAAADEEARAAHRLFVLRYVQPGLAGLIDGSVSTLAPLFAAAFATHNNWQTFLVGLAASIGAGISMGFTEALSDDGSITGRGSPWLRGLVCGIMTAVGGLGHTLPYLVPDSWTNAFSVATVLAALVVAVELLVISGIRTRYMETPFWRAALQVVLGGVLVLIAGVAIGSA
>CP029553.1|AWN47764.1|3644797_3646141_-|glycolate-oxidase-iron-sulfur-subunit
MQTSFTPAQLADPAMAASEKILRTCVHCGFCTATCPTYLLLGDELDSPRGRIYLIKDMLEGGKPASPEVVKHVDRCLSCLSCMTTCPSGVHYMHLVDHARAHIEKTYSRPAEDRLLRAVLARVLPYPNRFRLALLGATLGRPFRGIAARMPKVGNRLAAMLDLAPGALPTRSAHDRPGRFPAAGPRRGRVALLRGCAQSVLRPDFNEAAIRLLTRHGVEVVQARGEGCCGALTHHMGHEDSSHALARRTIDAWIAEMDGEGLDAIVVTASGCGTTIKDYGFMFRDDPAYAAKAARVAGLARDVTEYVTSLGLSEPVVETDLVVAYHSACSMQHGQGLRTEPKALLARAGFTVKDVPEGHICCGSAGTYNILQPELAAHLRARKVANIERVRPDVIATGNIGCATQIGKGTEIPIVHTVELLDWATGGPRPAALDGVADRRPALAAAE
>CP029553.1|AWN47763.1|3644047_3644644_+|nucleotide-exchange-factor-GrpE
MTPNDTENAARAYEPAAAEGAPASAPEAAPNGDALAALEAEKLDLKDKLLRTLADMENLRRRTEREVADARTYAVTNFARDMLNAADNVRRALESVPADARASAEGPLKALVDGIELTERDLIKTLERHGVKKVEPQGQRFDPNLHQAMFEVPNPDVTSGTVVQVVQTGYVIGDRVLRPALVGVAKGGPKAEAKPAEA
>CP029553.1|AWN47762.1|3641163_3643989_+|[protein-PII]-uridylyltransferase
MPDTTAIDPSDTDAALRALLAGIDQSLSEPTRLRERLVPELRRIIEAGRAEAERRLLTDRDGHACAGLICAQMDAVIRAIYDAVVKRLYRADNPTAAEQIAVVATGGYGRGLLAPGSDIDLLFLLPYKQTAWSESVVEAMLYVLWDLKLKVGHATRSVADCLREGRGDMTIRTALLESRFLFGDRALFEELETRFDREVVQGTAAEFVEAKLKERDARVQKSGASRYLVEPNVKDGKGGLRDLNTLFWIAKYTFRVKRAEDLVEAGLFTPDELRLFERCDEFLWRVRCHMHFVTGRSEERLSFGLQPRIAERLDYGARGGLAAVERFMKSYFLIAKDVGDLTAIVCAEMEARHAKRPPVLDRWLRRFKQHFRAPDLEADDFRIHTGRLDVRDDAAFERDPVNLIRLFWLSDRHDLAIHPDASRLATRSLALIGPMVRVDPEANRLFLELLTSQNAPETVLRHMNETGVLGRFVPDFGRIVAMMQFNMYHHFTVDEHLIRSLGVLGKIEAGELEDEHPLAHRIVGTIQNRRALYVAMFLHDIAKGRKDDHSIAGAAVARKLGPRFGLDAAETNTVAWLIEHHLLMSMTAQSRDLSDPKTIETFAGVVQSLERLKLLLILTIADIKAVGPGTWTAWKATLLRTLYYETEMVLSGGRSEVPRTDRVRLIQMRLREQLADWAAEEFDAYAARHYPHYWLKVDAGRQLKNARFIRAAAEAGHTVATTFETDLSRGVTELCVYSPDHPRLLAILTGACAASGGNIVDAQIFTTADGFVLDTITLSRAFERDEDELRRAGRIATAIERALKGEIRIADLVADKHPAKDRPRTFQVAPDLSIDNALSARETVLEISGLDRPGLLFDLTSALGRLNLNITSAHVATFGERAVDVFYVTDLTGTKVTQPDRQATIRRAVMAVFEADLPRGGPGRRGQKDARPEAAPAAGEA
>CP029553.1|AWN47761.1|3639935_3640934_-|aliphatic-sulfonates-ABC-transporter-substrate-binding-protein
MRIHRRALIGAALGAVGLAAAGTPALAQVKEPARKEPAREVRLDWATYNPVSLVLKEKGLLEKALAGDGVTVRWVQSLGSNKALEFLNAGSIDIGSTAGAAALLARINGNPIKAVYAFSRPEWTALVTRPNTGIAAVGDLKGRRVAVTRGTDPHIFLIRALRGAGLTERDVKLVLLQHPDGRTALDRGDVDAWAGLDPIMAAAEIENGDVLFHRDPAANTWGVLNVREDFATQNPELTRKVLAAYEEARNIALADPQELRRILVAATKLPEPVVARQLERTDLSQPAIGKLQAETILDAGTALLDAGVIPAGTDVGAAVQALIDPRFGPAAR
>CP029553.1|AWN47760.1|3639097_3639931_-|ABC-transporter-permease
MEAGPLTLAAAPVGEVPRRARRLPGGRALAGLILPLALALAWEGAVRAGLAQGRLVPPPSRVLATLWGLAASGELWTHVLASLTRVAAGFGFGALAGILVGALTGTLPPVRRLLDPSLQALRAIPSIAWVPLFILWFGIFEASKITLIAVGVFFPVYLGVAGAIAGVDRKLVEVGRVFRLSRLALARRILLPAVLPATLVALRTGLGLGFMFVAAAELLGASEGLGYLLLDGQQLGKPDQIVAAILAFAALGKLCDAVLVGLTQPLARWQDTARDSL
>CP029553.1|AWN47759.1|3638284_3639067_-|nitrate/sulfonate/bicarbonate-ABC-transporter-ATP-binding-protein
MLILDRLSKTYADGTRALADLSLEVRAGEIVALIGGSGCGKTTLLRLIAGLDRASAGRISLDGEGIAAPHPGVGIVFQEPRLLPWLSVADNVAFGLADLPKTERRERAAHALDRVGLSEHAGRWPRDLSGGQQQRVAIARAFVAAPKVLLLDEPFSALDALTRAGLHRHLLSLWEESRPTVLLVTHDVAEAVALADRAVVLRPKPGRIDDTISLSLSRPRQPSAPGSEAAARTIMASLDRSLRPEEPADRAKPDASALWW
>CP029553.1|AWN47758.1|3637685_3638195_-|peroxiredoxin
MDATELRSLQAPIKDRYRTDPDAAVITLKAQGSLDDGGIACKVETGRALAVAGLHPASGGSGAELCSGDMLLEALVACAGVTLKAVATALEIPLRKGLVKAEGDLDFRGTLGVDKGAPVGFRAIRMSFEVDSDAPQEKLDQLLKLTERYCVVFQTINQKPQLDVVMTRG
>CP029553.1|AWN47757.1|3637235_3637508_-|hypothetical-protein
MDQDREKLISTEQAKPTATDVNGIATFAVGRLAPSIAAGGTIHDVDPGLAKGIMRFQINASGASLVISVVCFFTSGFLHWTARRMLRNLQ
>CP029553.1|AWN47756.1|3636345_3637128_+|histidine/lysine/arginine/ornithine-ABC-transporter-ATP-binding-protein
MLAPSPTRPEAVAVRGLHKHFGPLEVLRGVSLSAREGEVVAILGSSGSGKSTLLRCINLLEVPEAGEVVVGDEAVAWRARRGGRVPADRAQVDRIRARVGMVFQSFNLWSHRTVLENVIEAPVHVLGRKRAECVAEAEGLLAKVGIADKRDHYPAHLSGGQQQRAAIARALAMHPRVLLFDEPTSALDPERVAEVLRVMRALAEEGRTMLVVTHEMAFARDVAHRVVFLHEGRILEDGPSEQVFSAPRSERFRQFLARGE
>CP029553.1|AWN47766.1|3649526_3650258_+|hypothetical-protein
MSVVTRIARSRAAQESLGFLGASYLKLVRRTNRFSLDPPDAYDWLTPLRPFIAAMWHGQHLMVPFVRRPQDRVATMVSRSVDGGVNTAVLERMGVRVMRGSGARRSSDVWAKGGVQALRGCLKALEGDESVAFSADVPKVSRRCGEGIVLLARMSGRPVVPTAVVTSRYIQFDSWDRASLGLPFGRGVMAFGEPIAVPRDLDAAGIEAVRQRIEADLNAVHARAFAQVGRIDPVHTRKGAPAR
>CP029553.1|AWN47767.1|3650254_3651559_+|3-deoxy-D-manno-octulosonic-acid-transferase
MRRDGVPALLRAYHYGLIAGEPALAGLLAWRRRRGKEDPVRLPERTGRPGKPRPAGPLVWAHGASIGEALSLLGLVERLTRRGFTVLVTSGTRTSAELLARRLPRGALHQFAPLDAPRYVARFLDHWRPDLALVAESEIWPNTILALHAREVPLILVNGRMSERSAKAWSRTPGIARALLSRIALCLAQSREEAERFARLGAPRVEAGGNLKFDAGPPPADPEPLRQLAGVVAGRPVWLAASTHPGEEAAAIAAHRALARRHPGLLTVVVPRHPERGPTVAADAAAAGLRVGRRAAGGQPHDKVDLYVADTVGELGLFYRLCPLAFVGGSLARHGGQNPIEPARLDTAILSGPHVRNFASVYAALERAGGARTVRDGQELTAAVGELLADPAGRQRMARAAAAAIEEAGGATDRAMAALEPFICQLMIAGRFAS
>CP029553.1|AWN47768.1|3651555_3652530_+|tetraacyldisaccharide-4'-kinase
MRRAPGFWWRDAPTPAARLLAPVATVYGALAARRMSAQGAAAPCPVVCIGNFTLGGAGKTPTALAVAAQLRDLGRRPAFLSRGYGGRLPGPVRVDPALHRADEVGDEPLLLARAAPAIVARDRVAGARACVAAGADVVVMDDGLQNPSLAKALVLAVFDGAVGLGNGRAFPAGPLRAPAAAQWPRIDAALAIGDGAPGERVLAQARALGLPALRGRLAPDPEAAATLGGRPVLAFAGIGRPEKFFSTLRDLGADLRETRAFPDHHAFTAAEAESLAVEAARRGLLLVTTEKDRVRLPAAMPVATLPVVLALDEPEGLAGLLRGL
>CP029553.1|AWN47769.1|3652515_3652737_-|DUF2093-domain-containing-protein
MLGRFERGGSGEAVVEYGDSNLRVVRPGRFVRCAVTGVEIPLDALRYWSVERQEAYADTDAVMARLRGASQTA
>CP029553.1|AWN50094.1|3652912_3653311_+|cytidine-deaminase
MFPTETLLSAARAVQARAHAPYSRFRVGAALRDETGAVHAGCNVENAAYPVGTCAEAGAIAAMVAAGGRRIAAILVLGDGEALVTPCGACRQRIREFAGPDTPIHVAGPGGVRRTFTLDALLPASFGPDNLA
>CP029553.1|AWN47770.1|3653307_3654129_+|purine-nucleoside-phosphorylase
MSAPHDPRVTQAAAFLRARGFDGPYTLALVTGTGLGPLADRIEDPVALPYGEIPHFPASGVSGHAGRLVAGLFGGRRVLLFQGRAHPYEHGDAAVMRVPVGVVAALGAPPLLLTNAAGSLLSEAGPGSLALVTDHINLSGLNPLVGEPSDARFVPMVDAYDPALRAALRDAAAVSGVPLHAGTYAWFSGPSFETPAEIRMAKILGADLVGMSTVPEVILARFFGLRVAALSLVTNYAAGFQTGAPHHAETKRVAAQAADDVGRLVAALLAGDL
>CP029553.1|AWN47771.1|3654151_3655465_+|thymidine-phosphorylase
MTLLPQELIRLKRDGHALPPEAIEAFIAGLTEGRVTEGQAAAFAMAVFFRGLSLPERVALTRAMTRSGTVLTWDLPGPVLDKHSTGGVGDTVSLALAPMVAACGGYVPMISGRGLGHTGGTLDKLDSIPGYATAPDVDLFRRVTREVGCAVIGQTPDLAPADRRLYAIRDVTGTVESLDLITASILAKKLAAGLQGLVMDVKAGSGAFMASAEEARGLAESLVTVANGAGLPTRALLTDMDQPLASAAGNAVEVAYALDYLSERRREPRFHAVTLALGAEMLVLGGLSADTRDATARLEEALASGRAADIFARMVTALGGPADLIEHPERHLPRAPVIRPIPAPTAGRVVAIATRYVGVAVIGLGGGRTRPQDGIDHAVGLTALAGLGDEVGPDRPLAIVHARSEAEAARAEAAILAAYRIGAEAPAAREPILERVG
>CP029553.1|AWN47772.1|3656575_3658111_-|exopolyphosphatase
MGLDQTALNEAALARIEPGAPVAIIDIGSNSVRLVAYSGISRAPTPLYNEKVLCGLGRNVLSTGRLNEEAVRRALQALARFRVLCETMRVGQVFVLATAAARDAENGPAFLEAAQAACGHPIELLSGRREAELSAYGVISGFHAPDGVVGDLGGGSLELVDVRGSAIGSGVTMPLGGLALQDLSGGSLKKARKLAAEALRKAGPQLDTLRGRTFYAVGGTWRALARLHQAARDYRLHVMHGYTIEPNDELSFLQVVEQSDAATLAAVETVSEARRPLLAYGAVVLEEVIRSGRPREIAISATGVREGLLFEKLDAAARARDPLLLAASELNRLRCRSPGHGPELQAWTDAFMASLSTPETADERRLRHAACLLADVGWRTHPDYRGEQSLNVIAHASFVGIDHPGRAYLAVAVFFRHEGVAPEKASPLLRQLAGPRLFEQARLLGAVLRVAFPVSVAMEGILPRTPLAMRDGAIVLTLPQDLKDLASDRLSNRLRGLGRLLGVEARIEIEG
>CP029553.1|AWN47773.1|3658176_3660507_-|RNA-degradosome-polyphosphate-kinase
MSDTAAGASAIPVLDETEATPATAEGARHDAVEGLAAPAAVRAADEADAAQDAARRAKADAVAAGRALRHEPGRFVNRELSWLQFNRRVLEEASNTGHPLLEQLRFLSISANNLDEFFMVRVAGLHDQVRAGLTAPSADGLSPAEQLARIDAEVSGLARDQQRRWRELREALHQNAIDLVEAMDLTAEEAAWLEDYFLQHIFPVLTPLAIDPAHPFPFIPNLGSTIALTLVRPRDARVLRALIRLPSIIDRFVRLPDPGGSGTARFIAIEQVIVLFTSRLFPGYLVKGQGGFRVVRDSDLEIEEEAEDLVRHFETALKQRRRGVVIRLEVDANMPEDLRTFVADELEIAVDAVFLVEGMLALNELSQIVGIDRPDLKFKPYNPRFPERIRESGGDCFAAIRQKDFIVHHPYESFDSVVQFLSQAARDPNVVAIKQTLYRTSSNSPIVAALAEAAEAGKSVTALVELKARFDEEANIRWARNLEKAGAQVVFGFIELKTHAKLSMVVRREGDRLVSYCHVGTGNYHPITARIYTDLSFFTADPVIGRDVSRIFNFITGYAEPAELERMAVSPLTLKARLLEHIAEEIAHAKAGRPAAIWIKCNSLVDTQIIDALYDASEAGVPIDCVVRGICCLRPGVPGLSENIRVKSIVGRFLEHGRVYAFGNGAGLPHPKARVYISSADLMSRNLDRRVEAMLPILNPTVHQQVLDQIMMANLLDNQQSWRVLASGASERIEPAEGEEPFNAHKYFMTNPSLSGRGKASKKSSPRALSRRAQRA
>CP029553.1|AWN47774.1|3660650_3661382_-|hypothetical-protein
MPDQPRQLALDLPVAPRFGLEDFLVSPTNEGAYARIEAWPEWPDRVLVLTGPPGSGKSHLAAIFAERSGALTVPVAAVTAEAVPELARADALVIEDADREPGRDEKALFHLLNLVRERGLSVVVTGSGPVEAWGLATPDLRSRLRLAPGASLAPPDEALLKVVLVKLFLDRQLVVDTSVVDALALRLDRSLARARDVVALLDREGLSRRRRITRPLALATLAALEGGEDEGSDEAGEEPEGEG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP017427	Methylobacterium sp. XJLW plasmid unnamed1, complete sequence	88924-88955	2	0.938
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP029174	Methylobacterium sp. DM1 plasmid pLVM1, complete sequence	227775-227806	2	0.938
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NC_011758	Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence	219695-219726	2	0.938
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP045296	Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence	276676-276707	5	0.844
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	556066-556097	5	0.844
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	63346-63378	6	0.818
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	386353-386385	6	0.818
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	63347-63378	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	161848-161879	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	162914-162945	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	386353-386384	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	161862-161893	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	161860-161891	6	0.812
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	161858-161889	6	0.812
CP029553_3	3.16\|3236392\|32\|CP029553\|CRISPRCasFinder,CRT	3236392-3236423	32	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	11809-11840	6	0.812
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	MF324907	Arthrobacter phage Beans, complete genome	27750-27781	6	0.812
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	MF324907	Arthrobacter phage Beans, complete genome	27750-27782	6	0.818
CP029553_5	5.7\|3647881\|33\|CP029553\|PILER-CR	3647881-3647913	33	KU998238	Gordonia phage Splinter, complete genome	25923-25955	6	0.818
CP029553_5	5.7\|3647881\|33\|CP029553\|PILER-CR	3647881-3647913	33	NC_030911	Gordonia phage Vendetta, complete genome	25923-25955	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1964742-1964774	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	2061365-2061397	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1860791-1860823	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	2011294-2011326	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1859811-1859843	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1962643-1962675	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1962645-1962677	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1860135-1860167	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1860185-1860217	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1860771-1860803	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1964933-1964965	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1964931-1964963	6	0.818
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1964895-1964927	6	0.818
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	KU998238	Gordonia phage Splinter, complete genome	25923-25954	6	0.812
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	NC_030911	Gordonia phage Vendetta, complete genome	25923-25954	6	0.812
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP025014	Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence	501911-501942	6	0.812
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP025508	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence	513999-514030	6	0.812
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP022667	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence	123574-123605	6	0.812
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050087	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence	512783-512814	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1964742-1964773	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	2061365-2061396	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1860791-1860822	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	2011294-2011325	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1859811-1859842	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1962643-1962674	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1962645-1962676	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1860135-1860166	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1860185-1860216	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1860771-1860802	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1964933-1964964	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1964931-1964962	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1964895-1964926	6	0.812
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	175558-175589	6	0.812
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP024314	Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence	1416891-1416922	6	0.812
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_025031	Bacterium enrichment culture clone 2a(2010) plasmid hyperthermophilic bacterial plasmid 2a, complete sequence	1420-1451	6	0.812
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NC_009475	Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence	43725-43756	6	0.812
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP022370	Bosea sp. AS-1 plasmid unnamed1, complete sequence	59603-59634	6	0.812
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP022370	Bosea sp. AS-1 plasmid unnamed1, complete sequence	166315-166346	6	0.812
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	962735-962766	6	0.812
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1186192-1186224	6	0.818
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	913216-913248	6	0.818
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1222754-1222786	6	0.818
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	732586-732618	6	0.818
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NC_009475	Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence	43723-43756	6	0.824
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP022370	Bosea sp. AS-1 plasmid unnamed1, complete sequence	59601-59634	6	0.824
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP022370	Bosea sp. AS-1 plasmid unnamed1, complete sequence	166315-166348	6	0.824
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	962735-962768	6	0.824
CP029553_3	3.7\|3236391\|33\|CP029553\|PILER-CR	3236391-3236423	33	LN997845	Streptomyces reticuli genome assembly TUE45, plasmid : IV	11809-11841	7	0.788
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	156598-156629	7	0.781
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	147854-147885	7	0.781
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	576879-576910	7	0.781
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	178506-178537	7	0.781
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP016082	Streptomyces sp. SAT1 plasmid unnamed2, complete sequence	102558-102589	7	0.781
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1614009-1614040	7	0.781
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP023549	Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence	730466-730497	7	0.781
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_LR594663	Variovorax sp. RA8 plasmid 2	350764-350795	7	0.781
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	MT776811	Arthrobacter phage King2, complete genome	27708-27739	7	0.781
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	NC_041931	Arthrobacter phage Jawnski, complete genome	27721-27752	7	0.781
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	NC_042014	Arthrobacter phage Piccoletto, complete genome	27726-27757	7	0.781
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	MF377442	Arthrobacter phage Franzy, complete genome	27711-27742	7	0.781
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	NC_041930	Arthrobacter phage Brent, complete genome	27712-27743	7	0.781
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	321070-321101	7	0.781
CP029553_4	4.13\|3388224\|33\|CP029553\|PILER-CR	3388224-3388256	33	NZ_LR594663	Variovorax sp. RA8 plasmid 2	350763-350795	7	0.788
CP029553_4	4.20\|3388651\|33\|CP029553\|PILER-CR	3388651-3388683	33	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	133873-133905	7	0.788
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	MT776811	Arthrobacter phage King2, complete genome	27708-27740	7	0.788
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	NC_041931	Arthrobacter phage Jawnski, complete genome	27721-27753	7	0.788
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	NC_042014	Arthrobacter phage Piccoletto, complete genome	27726-27758	7	0.788
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	MF377442	Arthrobacter phage Franzy, complete genome	27711-27743	7	0.788
CP029553_4	4.21\|3388712\|33\|CP029553\|PILER-CR	3388712-3388744	33	NC_041930	Arthrobacter phage Brent, complete genome	27712-27744	7	0.788
CP029553_4	4.22\|3388773\|33\|CP029553\|PILER-CR	3388773-3388805	33	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	437329-437361	7	0.788
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	183960-183992	7	0.788
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	421599-421630	7	0.781
CP029553_5	5.28\|3647943\|32\|CP029553\|CRISPRCasFinder,CRT	3647943-3647974	32	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	300653-300684	7	0.781
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP021029	Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence	134084-134115	7	0.781
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	864255-864286	7	0.781
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP014600	Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence	183961-183992	7	0.781
CP029553_5	5.35\|3648370\|32\|CP029553\|CRISPRCasFinder,CRT	3648370-3648401	32	NZ_CP029777	Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence	322353-322384	7	0.781
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	440878-440909	7	0.781
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	834735-834766	7	0.781
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MN813686	Mycobacterium phage BirdsNest, complete genome	25507-25538	7	0.781
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP014310	Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence	344665-344696	7	0.781
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	271404-271435	7	0.781
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP007214	Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence	80059-80090	7	0.781
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP007214	Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence	88827-88858	7	0.781
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP011667	Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence	76971-77002	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	418013-418044	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1473239-1473270	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	890251-890282	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1622990-1623021	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1574884-1574915	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1528584-1528615	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1395707-1395738	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1355761-1355792	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	890315-890346	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1298208-1298239	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	544701-544732	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1574882-1574913	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1457900-1457931	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1394729-1394760	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1439266-1439297	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1439257-1439288	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	890101-890132	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1395699-1395730	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1395052-1395083	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1395690-1395721	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	890079-890110	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1481424-1481455	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1284701-1284732	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1425370-1425401	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1473394-1473425	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1473375-1473406	7	0.781
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1473358-1473389	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NC_019846	Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence	141447-141478	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NC_007960	Nitrobacter hamburgensis X14 plasmid 2, complete sequence	3605-3636	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP021826	Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence	41756-41787	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP044544	Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence	41409-41440	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP021832	Sinorhizobium meliloti strain HM006 plasmid accessoryA, complete sequence	12620-12651	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	134930-134961	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP026529	Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence	172526-172557	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP039909	Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence	49934-49965	7	0.781
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	732698-732729	7	0.781
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NC_007960	Nitrobacter hamburgensis X14 plasmid 2, complete sequence	3603-3636	7	0.794
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	732696-732729	7	0.794
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP050083	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence	156597-156629	8	0.758
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP049733	Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence	147853-147885	8	0.758
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP020952	Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence	576879-576911	8	0.758
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	105303-105335	8	0.758
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP053207	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence	178505-178537	8	0.758
CP029553_3	3.3\|3236147\|33\|CP029553\|PILER-CR	3236147-3236179	33	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1252366-1252398	8	0.758
CP029553_3	3.3\|3236147\|33\|CP029553\|PILER-CR	3236147-3236179	33	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	987502-987534	8	0.758
CP029553_3	3.4\|3236208\|33\|CP029553\|PILER-CR	3236208-3236240	33	NZ_CP009155	Burkholderia pseudomallei strain TSV202 plasmid 1, complete sequence	263555-263587	8	0.758
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP023738	Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence	243286-243317	8	0.75
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	590187-590218	8	0.75
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP053022	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence	105304-105335	8	0.75
CP029553_3	3.12\|3236148\|32\|CP029553\|CRISPRCasFinder,CRT	3236148-3236179	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1252366-1252397	8	0.75
CP029553_3	3.12\|3236148\|32\|CP029553\|CRISPRCasFinder,CRT	3236148-3236179	32	NZ_CP015040	Rhodovulum sp. P5 plasmid pRGUI01, complete sequence	139568-139599	8	0.75
CP029553_3	3.13\|3236209\|32\|CP029553\|CRISPRCasFinder,CRT	3236209-3236240	32	NZ_CP009155	Burkholderia pseudomallei strain TSV202 plasmid 1, complete sequence	263556-263587	8	0.75
CP029553_3	3.13\|3236209\|32\|CP029553\|CRISPRCasFinder,CRT	3236209-3236240	32	MN813682	Microbacterium phage Matzah, complete genome	10296-10327	8	0.75
CP029553_3	3.13\|3236209\|32\|CP029553\|CRISPRCasFinder,CRT	3236209-3236240	32	MK937591	Microbacterium phage Cinna, complete genome	10230-10261	8	0.75
CP029553_3	3.16\|3236392\|32\|CP029553\|CRISPRCasFinder,CRT	3236392-3236423	32	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	915541-915572	8	0.75
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP020716	Cnuibacter physcomitrellae strain XA(T) plasmid unnamed1, complete sequence	104364-104395	8	0.75
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	152627-152658	8	0.75
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	289848-289879	8	0.75
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP013265	Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence	203319-203350	8	0.75
CP029553_4	4.4\|3388346\|32\|CP029553\|CRISPRCasFinder,CRT	3388346-3388377	32	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	385646-385677	8	0.75
CP029553_4	4.9\|3388651\|32\|CP029553\|CRISPRCasFinder,CRT	3388651-3388682	32	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	133873-133904	8	0.75
CP029553_4	4.10\|3388712\|32\|CP029553\|CRISPRCasFinder,CRT	3388712-3388743	32	NZ_AP022339	Mameliella alba strain KU6B plasmid pKUB112, complete sequence	109005-109036	8	0.75
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	437330-437361	8	0.75
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP013426	Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence	56171-56202	8	0.75
CP029553_4	4.15\|3388346\|33\|CP029553\|PILER-CR	3388346-3388378	33	NZ_CP024940	Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence	385646-385678	8	0.758
CP029553_5	5.7\|3647881\|33\|CP029553\|PILER-CR	3647881-3647913	33	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	421599-421631	8	0.758
CP029553_5	5.7\|3647881\|33\|CP029553\|PILER-CR	3647881-3647913	33	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	193875-193907	8	0.758
CP029553_5	5.8\|3647942\|33\|CP029553\|PILER-CR	3647942-3647974	33	MH825712	Microbacterium phage ValentiniPuff, complete genome	47307-47339	8	0.758
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	509332-509364	8	0.758
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	741539-741571	8	0.758
CP029553_5	5.16\|3648430\|33\|CP029553\|PILER-CR	3648430-3648462	33	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	440878-440910	8	0.758
CP029553_5	5.16\|3648430\|33\|CP029553\|PILER-CR	3648430-3648462	33	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	834735-834767	8	0.758
CP029553_5	5.25\|3647760\|32\|CP029553\|CRISPRCasFinder,CRT	3647760-3647791	32	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	185327-185358	8	0.75
CP029553_5	5.25\|3647760\|32\|CP029553\|CRISPRCasFinder,CRT	3647760-3647791	32	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	13819-13850	8	0.75
CP029553_5	5.25\|3647760\|32\|CP029553\|CRISPRCasFinder,CRT	3647760-3647791	32	NC_019388	Thermus oshimai JL-2 plasmid pTHEOS02, complete sequence	14083-14114	8	0.75
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	NZ_CP018096	Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence	193876-193907	8	0.75
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	666703-666734	8	0.75
CP029553_5	5.27\|3647882\|32\|CP029553\|CRISPRCasFinder,CRT	3647882-3647913	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2411717-2411748	8	0.75
CP029553_5	5.28\|3647943\|32\|CP029553\|CRISPRCasFinder,CRT	3647943-3647974	32	NZ_CP018910	Acinetobacter pittii strain XJ88 plasmid unnamed1, complete sequence	1681-1712	8	0.75
CP029553_5	5.28\|3647943\|32\|CP029553\|CRISPRCasFinder,CRT	3647943-3647974	32	NZ_CP010857	Marinovum algicola DG 898 plasmid pMaD2, complete sequence	74759-74790	8	0.75
CP029553_5	5.28\|3647943\|32\|CP029553\|CRISPRCasFinder,CRT	3647943-3647974	32	MH825712	Microbacterium phage ValentiniPuff, complete genome	47308-47339	8	0.75
CP029553_5	5.29\|3648004\|32\|CP029553\|CRISPRCasFinder,CRT	3648004-3648035	32	HQ332141	Halorubrum phage CGphi46 genomic sequence	1550-1581	8	0.75
CP029553_5	5.29\|3648004\|32\|CP029553\|CRISPRCasFinder,CRT	3648004-3648035	32	NZ_CP040763	Paracoccus sp. 2251 plasmid unnamed4, complete sequence	99370-99401	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP023408	Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence	509332-509363	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	627999-628030	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	604712-604743	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	575922-575953	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	482536-482567	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	495756-495787	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1105581-1105612	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	604714-604745	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	454033-454064	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	186352-186383	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP021814	Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence	741539-741570	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	343608-343639	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	366341-366372	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	530563-530594	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP040764	Paracoccus sp. 2251 plasmid unnamed3, complete sequence	200129-200160	8	0.75
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1278534-1278565	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	994070-994101	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KT783672	Arthrobacter phage TymAbreu, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MF140420	Arthrobacter phage Mariposa, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576951	Arthrobacter phage Copper, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576955	Arthrobacter phage Hunnie, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KT355475	Arthrobacter phage Sandman, complete genome	14015-14046	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KX576642	Arthrobacter phage Massimo, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KX610765	Arthrobacter phage Prospero, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160670	Arthrobacter phage Toulouse, complete genome	13704-13735	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	NC_028692	Arthrobacter phage Decurro, complete genome	13909-13940	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MN813695	Arthrobacter phage LouisXIV, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576950	Arthrobacter phage CGermain, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH779506	Arthrobacter phage Guntur, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MF140426	Arthrobacter phage Seume, complete genome	13704-13735	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576948	Arthrobacter phage Azathoth, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160655	Arthrobacter phage Maggie, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MF140417	Arthrobacter phage Link, complete genome	13906-13937	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KY434670	Arthrobacter phage Chestnut, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MF140433	Arthrobacter phage TinoCrisci, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576957	Arthrobacter phage Inspire2, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576961	Arthrobacter phage Ronnie, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KX443695	Arthrobacter phage Courtney3, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160674	Arthrobacter phage Yank, complete genome	13909-13940	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160657	Arthrobacter phage Moloch, complete genome	14015-14046	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160658	Arthrobacter phage Muttlie, complete genome	13909-13940	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MK737943	Arthrobacter phage Arby, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	MH576952	Arthrobacter phage Dewayne, complete genome	13941-13972	8	0.75
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KU160667	Arthrobacter phage Stratus, complete genome	14015-14046	8	0.75
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	497195-497226	8	0.75
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP048282	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence	238775-238806	8	0.75
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	MT776811	Arthrobacter phage King2, complete genome	11174-11205	8	0.75
CP029553_5	5.35\|3648370\|32\|CP029553\|CRISPRCasFinder,CRT	3648370-3648401	32	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	22759-22790	8	0.75
CP029553_5	5.35\|3648370\|32\|CP029553\|CRISPRCasFinder,CRT	3648370-3648401	32	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	255001-255032	8	0.75
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NC_020062	Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence	1091762-1091793	8	0.75
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP012748	Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence	194326-194357	8	0.75
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_017791	Deinococcus gobiensis I-0 plasmid P2, complete sequence	199299-199330	8	0.75
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_KY503037	Pseudomonas fluorescens strain PC24 plasmid pPHE24, complete sequence	91378-91409	8	0.75
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_MH061177	Pseudomonas fluorescens strain P69 plasmid pG69, complete sequence	100994-101025	8	0.75
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MF417932	Uncultured Caudovirales phage clone 3S_12, partial genome	7450-7481	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_006823	Aromatoleum aromaticum EbN1 plasmid 1, complete sequence	9525-9556	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP020900	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence	78397-78428	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	615953-615984	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013526	Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence	329477-329508	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013556	Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence	342241-342272	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013562	Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence	374792-374823	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013579	Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence	329417-329448	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013531	Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence	348873-348904	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013536	Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence	572109-572140	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013541	Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence	335663-335694	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013546	Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence	343838-343869	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013567	Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence	342241-342272	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013584	Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence	348873-348904	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013573	Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence	329417-329448	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_010997	Rhizobium etli CIAT 652 plasmid pC, complete sequence	328983-329014	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	85524-85555	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_025133	Sphingobium wenxiniae strain JZ-1 plasmid pPBA, complete sequence	16787-16818	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_008308	Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence	22227-22258	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_013858	Azospirillum sp. B510 plasmid pAB510d, complete sequence	515454-515485	8	0.75
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP053023	Sphingobium yanoikuyae strain YC-XJ2 plasmid p-B-Sy, complete sequence	249823-249854	8	0.75
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP022994	Paraburkholderia aromaticivorans strain BN5 plasmid pBN4, complete sequence	13058-13089	8	0.75
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP024583	Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence	100603-100634	8	0.75
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP026110	Paraburkholderia hospita strain DSM 17164 plasmid pEMT1, complete sequence	97343-97374	8	0.75
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	1784631-1784662	8	0.75
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	28630-28661	8	0.75
CP029553_5	5.45\|3648991\|32\|CP029553\|CRISPRCasFinder,CRT	3648991-3649022	32	MK686071	Streptomyces phage Mischief19, complete genome	304-335	8	0.75
CP029553_5	5.45\|3648991\|32\|CP029553\|CRISPRCasFinder,CRT	3648991-3649022	32	MH825712	Microbacterium phage ValentiniPuff, complete genome	50105-50136	8	0.75
CP029553_5	5.48\|3649174\|32\|CP029553\|CRISPRCasFinder,CRT	3649174-3649205	32	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	986946-986977	8	0.75
CP029553_5	5.48\|3649174\|32\|CP029553\|CRISPRCasFinder,CRT	3649174-3649205	32	MN693799	Marine virus AFVG_250M1075, complete genome	40439-40470	8	0.75
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP044544	Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence	41407-41440	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP021796	Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence	134928-134961	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NC_019846	Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence	141447-141480	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP021826	Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence	41756-41789	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP021832	Sinorhizobium meliloti strain HM006 plasmid accessoryA, complete sequence	12620-12653	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP026529	Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence	172526-172559	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	NZ_CP039909	Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence	49934-49967	8	0.765
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	MH588544	Caulobacter phage CcrBL10, complete genome	157931-157964	8	0.765
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NZ_CP013110	Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence	1186190-1186224	8	0.771
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	913216-913250	8	0.771
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	1222754-1222788	8	0.771
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	732586-732620	8	0.771
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NC_031004	Gordonia phage Nyceirae, complete genome	11738-11772	8	0.771
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_LN832562	Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence	590186-590218	9	0.727
CP029553_3	3.1\|3236025\|33\|CP029553\|PILER-CR	3236025-3236057	33	NZ_CP039909	Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence	284104-284136	9	0.727
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP039909	Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence	284104-284135	9	0.719
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP023037	Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence	101911-101942	9	0.719
CP029553_3	3.11\|3236087\|32\|CP029553\|CRISPRCasFinder,CRT	3236087-3236118	32	NZ_AP018442	Undibacterium sp. YM2 plasmid pUYM01, complete sequence	117074-117105	9	0.719
CP029553_3	3.13\|3236209\|32\|CP029553\|CRISPRCasFinder,CRT	3236209-3236240	32	NZ_CP043508	Acetobacter sp. KACC 21233 plasmid unnamed2, complete sequence	87431-87462	9	0.719
CP029553_3	3.16\|3236392\|32\|CP029553\|CRISPRCasFinder,CRT	3236392-3236423	32	NZ_AP014580	Burkholderia sp. RPE67 plasmid p2, complete sequence	37607-37638	9	0.719
CP029553_3	3.16\|3236392\|32\|CP029553\|CRISPRCasFinder,CRT	3236392-3236423	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	1550074-1550105	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1568330-1568361	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	606044-606075	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP006991	Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence	510856-510887	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP021128	Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence	460885-460916	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	CP007645	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence	519189-519220	9	0.719
CP029553_3	3.19\|3236576\|32\|CP029553\|CRISPRCasFinder,CRT	3236576-3236607	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	1459660-1459691	9	0.719
CP029553_4	4.1\|3388163\|32\|CP029553\|CRISPRCasFinder,CRT	3388163-3388194	32	NC_011961	Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence	357971-358002	9	0.719
CP029553_4	4.1\|3388163\|32\|CP029553\|CRISPRCasFinder,CRT	3388163-3388194	32	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	603295-603326	9	0.719
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	150383-150414	9	0.719
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP050084	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence	425794-425825	9	0.719
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP053209	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence	307279-307310	9	0.719
CP029553_4	4.4\|3388346\|32\|CP029553\|CRISPRCasFinder,CRT	3388346-3388377	32	NC_048021	Gordonia phage Daredevil, complete genome	46739-46770	9	0.719
CP029553_4	4.9\|3388651\|32\|CP029553\|CRISPRCasFinder,CRT	3388651-3388682	32	NZ_CP050092	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence	434351-434382	9	0.719
CP029553_4	4.9\|3388651\|32\|CP029553\|CRISPRCasFinder,CRT	3388651-3388682	32	NZ_CP016287	Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence	260976-261007	9	0.719
CP029553_4	4.9\|3388651\|32\|CP029553\|CRISPRCasFinder,CRT	3388651-3388682	32	NZ_CP022565	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence	373327-373358	9	0.719
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	1362-1393	9	0.719
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	1072739-1072770	9	0.719
CP029553_4	4.12\|3388163\|33\|CP029553\|PILER-CR	3388163-3388195	33	NC_007766	Rhizobium etli CFN 42 plasmid p42f, complete sequence	603295-603327	9	0.727
CP029553_4	4.13\|3388224\|33\|CP029553\|PILER-CR	3388224-3388256	33	NZ_CP030127	Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence	152627-152659	9	0.727
CP029553_4	4.13\|3388224\|33\|CP029553\|PILER-CR	3388224-3388256	33	NZ_LR134450	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence	150382-150414	9	0.727
CP029553_4	4.22\|3388773\|33\|CP029553\|PILER-CR	3388773-3388805	33	NZ_CP034811	Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence	1361-1393	9	0.727
CP029553_5	5.5\|3647759\|33\|CP029553\|PILER-CR	3647759-3647791	33	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	185326-185358	9	0.727
CP029553_5	5.9\|3648003\|33\|CP029553\|PILER-CR	3648003-3648035	33	HQ332141	Halorubrum phage CGphi46 genomic sequence	1549-1581	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP018230	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence	482535-482567	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP016289	Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence	495755-495787	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP023000	Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence	1105580-1105612	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP022566	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence	366340-366372	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	627999-628031	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP050105	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence	604712-604744	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP049732	Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence	575922-575954	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP050110	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence	604714-604746	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP030764	Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence	454033-454065	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	186352-186384	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	343608-343640	9	0.727
CP029553_5	5.10\|3648064\|33\|CP029553\|PILER-CR	3648064-3648096	33	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	530563-530595	9	0.727
CP029553_5	5.14\|3648308\|33\|CP029553\|PILER-CR	3648308-3648340	33	NZ_CP032676	Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence	497194-497226	9	0.727
CP029553_5	5.15\|3648369\|33\|CP029553\|PILER-CR	3648369-3648401	33	NZ_AP014706	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence	255001-255033	9	0.727
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	MT708548	Streptomyces phage Salutena, complete genome	35405-35436	9	0.719
CP029553_5	5.25\|3647760\|32\|CP029553\|CRISPRCasFinder,CRT	3647760-3647791	32	CP040467	Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence	6065-6096	9	0.719
CP029553_5	5.29\|3648004\|32\|CP029553\|CRISPRCasFinder,CRT	3648004-3648035	32	NZ_CP054603	Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed4, complete sequence	92052-92083	9	0.719
CP029553_5	5.29\|3648004\|32\|CP029553\|CRISPRCasFinder,CRT	3648004-3648035	32	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	927911-927942	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP018001	Rhizobium sp. Y9 plasmid pY9, complete sequence	260800-260831	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	20181-20212	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NC_022536	Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence	454448-454479	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP039913	Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence	266744-266775	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	549103-549134	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	CP036360	Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence	280428-280459	9	0.719
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	584694-584725	9	0.719
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	822975-823006	9	0.719
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	NC_009468	Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence	41171-41202	9	0.719
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP006369	Aureimonas sp. AU20 plasmid pAU20b, complete sequence	130403-130434	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP009294	Novosphingobium pentaromativorans US6-1 plasmid pLA1, complete sequence	23076-23107	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	427181-427212	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	1042058-1042089	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	698299-698330	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP011771	Croceicoccus naphthovorans strain PQ-2 plasmid p1, complete sequence	119608-119639	9	0.719
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	513994-514025	9	0.719
CP029553_5	5.38\|3648564\|32\|CP029553\|CRISPRCasFinder,CRT	3648564-3648595	32	MN096374	Microbacterium phage Roman, complete genome	38349-38380	9	0.719
CP029553_5	5.38\|3648564\|32\|CP029553\|CRISPRCasFinder,CRT	3648564-3648595	32	MK937596	Microbacterium phage PhillyPhilly, complete genome	37680-37711	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	483727-483758	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1738312-1738343	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1825482-1825513	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP015231	Epibacterium mobile F1926 plasmid unnamed1, complete sequence	1134412-1134443	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1730565-1730596	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1738381-1738412	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1738382-1738413	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP032695	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence	2228193-2228224	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1738481-1738512	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	688908-688939	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP017244	Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence	102737-102768	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1738479-1738510	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1738458-1738489	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	432431-432462	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1213901-1213932	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	15606-15637	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP023071	Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence	78295-78326	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	AP017627	Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome	89702-89733	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	AM040673	Phage phiSMA9 viral zot gene, rstA gene (partial), and ORF1-5	3728-3759	9	0.719
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_007189	Stenotrophomonas phage phiSMA9, complete genome	3728-3759	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013589	Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence	332235-332266	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_012586	Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence	1484783-1484814	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	1843503-1843534	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1783800-1783831	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	465598-465629	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	869526-869557	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	5766565-5766596	9	0.719
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	943597-943628	9	0.719
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	247982-248013	9	0.719
CP029553_5	5.43\|3648869\|32\|CP029553\|CRISPRCasFinder,CRT	3648869-3648900	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	94161-94192	9	0.719
CP029553_5	5.48\|3649174\|32\|CP029553\|CRISPRCasFinder,CRT	3649174-3649205	32	NZ_CP042167	Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence	45654-45685	9	0.719
CP029553_5	5.48\|3649174\|32\|CP029553\|CRISPRCasFinder,CRT	3649174-3649205	32	NZ_CP046610	Burkholderia contaminans strain XL73 plasmid unnamed1, complete sequence	114982-115013	9	0.719
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NC_031004	Gordonia phage Nyceirae, complete genome	11740-11772	9	0.727
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	33436-33468	9	0.727
CP029553_5	5.49\|3649235\|33\|CP029553\|CRISPRCasFinder,CRT	3649235-3649267	33	NC_011370	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence	183475-183507	9	0.727
CP029553_5	5.52\|3648991\|34\|CP029553\|PILER-CR	3648991-3649024	34	MK686071	Streptomyces phage Mischief19, complete genome	304-337	9	0.735
CP029553_5	5.52\|3648991\|34\|CP029553\|PILER-CR	3648991-3649024	34	MH825712	Microbacterium phage ValentiniPuff, complete genome	50105-50138	9	0.735
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_LR134460	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence	230205-230236	10	0.688
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	1793557-1793588	10	0.688
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP024310	Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence	1244377-1244408	10	0.688
CP029553_3	3.10\|3236026\|32\|CP029553\|CRISPRCasFinder,CRT	3236026-3236057	32	NZ_CP023064	Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence	1063210-1063241	10	0.688
CP029553_3	3.12\|3236148\|32\|CP029553\|CRISPRCasFinder,CRT	3236148-3236179	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	987502-987533	10	0.688
CP029553_4	4.1\|3388163\|32\|CP029553\|CRISPRCasFinder,CRT	3388163-3388194	32	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	12800-12831	10	0.688
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	230319-230350	10	0.688
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	391493-391524	10	0.688
CP029553_4	4.2\|3388224\|32\|CP029553\|CRISPRCasFinder,CRT	3388224-3388255	32	NZ_CP030263	Ensifer adhaerens strain Corn53 plasmid AA, complete sequence	35932-35963	10	0.688
CP029553_4	4.8\|3388590\|32\|CP029553\|CRISPRCasFinder,CRT	3388590-3388621	32	NZ_CP034351	Streptomyces sp. W1SF4 plasmid p1, complete sequence	323735-323766	10	0.688
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_MN366357	Bacterium plasmid pALTS28, complete sequence	23664-23695	10	0.688
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP020047	Thiomonas intermedia strain ATCC 15466 plasmid pXI1, complete sequence	20419-20450	10	0.688
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	AJ297913	Uncultured bacterium plasmid pIPO2T, complete sequence	19114-19145	10	0.688
CP029553_4	4.11\|3388773\|32\|CP029553\|CRISPRCasFinder,CRT	3388773-3388804	32	NZ_CP040765	Paracoccus sp. 2251 plasmid unnamed1, complete sequence	30487-30518	10	0.688
CP029553_4	4.12\|3388163\|33\|CP029553\|PILER-CR	3388163-3388195	33	NZ_LR134461	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence	12800-12832	10	0.697
CP029553_4	4.15\|3388346\|33\|CP029553\|PILER-CR	3388346-3388378	33	NC_048021	Gordonia phage Daredevil, complete genome	46739-46771	10	0.697
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	94482-94513	10	0.688
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019795	Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence	212760-212791	10	0.688
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	22544-22575	10	0.688
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	118841-118872	10	0.688
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	121557-121588	10	0.688
CP029553_5	5.22\|3647577\|32\|CP029553\|CRISPRCasFinder,CRT	3647577-3647608	32	NZ_AP019793	Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence	123902-123933	10	0.688
CP029553_5	5.29\|3648004\|32\|CP029553\|CRISPRCasFinder,CRT	3648004-3648035	32	KX241618	Xanthomonas phage Xoo-sp2, complete genome	3477-3508	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050095	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence	67148-67179	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	400831-400862	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NC_008381	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence	264225-264256	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP020897	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence	36421-36452	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP016500	Agrobacterium sp. RAC06 plasmid pBSY240_1, complete sequence	281768-281799	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP053443	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence	51461-51492	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP016291	Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence	60367-60398	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	401015-401046	10	0.688
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NZ_CP045856	Agrobacterium sp. MA01 plasmid punanmed2, complete sequence	14330-14361	10	0.688
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	NC_009806	Kineococcus radiotolerans SRS30216 = ATCC BAA-149 plasmid pKRAD01, complete sequence	87212-87243	10	0.688
CP029553_5	5.31\|3648126\|32\|CP029553\|CRISPRCasFinder,CRT	3648126-3648157	32	KT355473	Arthrobacter phage Jessica, complete genome	13941-13972	10	0.688
CP029553_5	5.35\|3648370\|32\|CP029553\|CRISPRCasFinder,CRT	3648370-3648401	32	NZ_CP020812	Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed3, complete sequence	63484-63515	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	672510-672541	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MK510999	Pseudomonas phage BR58, partial genome	43345-43376	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MK511000	Pseudomonas phage CF16, partial genome	7576-7607	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	702226-702257	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1660347-1660378	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP049038	Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence	143652-143683	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1659369-1659400	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1660340-1660371	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1659661-1659692	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1660329-1660360	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_AP022319	Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence	341311-341342	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	699095-699126	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MH020248	Mycobacterium phage Panamaxus, complete genome	22889-22920	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MN062712	Mycobacterium phage Pocahontas, complete genome	22886-22917	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	KX640831	Mycobacterium phage Margo, complete genome	22915-22946	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MG812492	Mycobacterium phage Lambert1, complete genome	22889-22920	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MK524496	Mycobacterium phage Veracruz, complete genome	22889-22920	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MH976517	Mycobacterium phage Popcicle, complete genome	22886-22917	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	KT326767	Mycobacterium phage Texage, complete genome	22890-22921	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	KM592966	Mycobacterium phage QuinnKiro, complete genome	22889-22920	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MH316563	Mycobacterium phage Hookmount, complete genome	22890-22921	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	KX670828	Mycobacterium phage Todacoro, complete genome	22889-22920	10	0.688
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	MK494127	Mycobacterium phage Noella, complete genome	22890-22921	10	0.688
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_LN832560	Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence	105345-105376	10	0.688
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	433193-433224	10	0.688
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	1366160-1366191	10	0.688
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP022567	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence	24882-24913	10	0.688
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NZ_CP029374	Acidovorax citrulli strain M6 plasmid pACM6, complete sequence	12779-12810	10	0.688
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	316849-316880	10	0.688
CP029553_5	5.44\|3648930\|32\|CP029553\|CRISPRCasFinder,CRT	3648930-3648961	32	MT723933	Streptomyces phage Keanu, complete genome	68887-68918	10	0.688
CP029553_5	5.45\|3648991\|32\|CP029553\|CRISPRCasFinder,CRT	3648991-3649022	32	NZ_CP028970	Aminobacter sp. MSH1 plasmid pUSP2, complete sequence	203858-203889	10	0.688
CP029553_5	5.45\|3648991\|32\|CP029553\|CRISPRCasFinder,CRT	3648991-3649022	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1355471-1355502	10	0.688
CP029553_5	5.45\|3648991\|32\|CP029553\|CRISPRCasFinder,CRT	3648991-3649022	32	NC_012858	Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence	574719-574750	10	0.688
CP029553_5	5.46\|3649052\|32\|CP029553\|CRISPRCasFinder,CRT	3649052-3649083	32	NC_017273	Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence	106770-106801	10	0.688
CP029553_5	5.46\|3649052\|32\|CP029553\|CRISPRCasFinder,CRT	3649052-3649083	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	542996-543027	10	0.688
CP029553_5	5.46\|3649052\|32\|CP029553\|CRISPRCasFinder,CRT	3649052-3649083	32	NZ_CP014142	Thermus parvatiensis strain RL plasmid pTP143, complete sequence	63374-63405	10	0.688
CP029553_5	5.46\|3649052\|32\|CP029553\|CRISPRCasFinder,CRT	3649052-3649083	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1099668-1099699	10	0.688
CP029553_5	5.46\|3649052\|32\|CP029553\|CRISPRCasFinder,CRT	3649052-3649083	32	NC_017590	Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence	85749-85780	10	0.688
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	NC_011370	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence	183475-183509	10	0.714
CP029553_5	5.56\|3649235\|35\|CP029553\|PILER-CR	3649235-3649269	35	MN892485	Gordonia phage Kuwabara, complete genome	30570-30604	10	0.714
CP029553_3	3.13\|3236209\|32\|CP029553\|CRISPRCasFinder,CRT	3236209-3236240	32	NZ_CP010863	Marinovum algicola DG 898 plasmid pMaD8, complete sequence	88744-88775	11	0.656
CP029553_5	5.30\|3648065\|32\|CP029553\|CRISPRCasFinder,CRT	3648065-3648096	32	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	661191-661222	11	0.656
CP029553_5	5.34\|3648309\|32\|CP029553\|CRISPRCasFinder,CRT	3648309-3648340	32	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	199068-199099	11	0.656
CP029553_5	5.36\|3648431\|32\|CP029553\|CRISPRCasFinder,CRT	3648431-3648462	32	NZ_CP015989	Sphingobium sp. EP60837 plasmid pEP2, complete sequence	112147-112178	11	0.656
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	348637-348668	11	0.656
CP029553_5	5.41\|3648747\|32\|CP029553\|CRISPRCasFinder,CRT	3648747-3648778	32	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	505726-505757	11	0.656
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP054616	Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence	357132-357163	11	0.656
CP029553_5	5.51\|3648930\|34\|CP029553\|PILER-CR	3648930-3648963	34	MT723933	Streptomyces phage Keanu, complete genome	68885-68918	11	0.676
CP029553_5	5.42\|3648808\|32\|CP029553\|CRISPRCasFinder,CRT	3648808-3648839	32	NZ_CP013436	Burkholderia latens strain AU17928 isolate AU17928 plasmid pAU17928, complete sequence	12936-12967	13	0.594

1. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP017427 (Methylobacterium sp. XJLW plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.938

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
ttcccgatcggcatcgtcttcctgcagccggt	Protospacer
*********** ****** *************

2. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029174 (Methylobacterium sp. DM1 plasmid pLVM1, complete sequence) position: , mismatch: 2, identity: 0.938

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
ttcccgatcggcatcgtcttcctgcagccggt	Protospacer
*********** ****** *************

3. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NC_011758 (Methylorubrum extorquens CM4 plasmid pCMU01, complete sequence) position: , mismatch: 2, identity: 0.938

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
ttcccgatcggcatcgtcttcctgcagccggt	Protospacer
*********** ****** *************

4. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP045296 (Paenibacillus cellulositrophicus strain KACC 16577 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.844

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ttgccgacctcttccagcgtgcgcgtgcggcc	Protospacer
* ************ ******* ***** *.*

5. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 5, identity: 0.844

-cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
gcat-catccgggccggcgacgcctgagcggag	Protospacer
 **. *****.************* *******.

6. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.818

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cctggccgcccggcagcgccggcgccgcttcgg	Protospacer
*** *   ****************** * ****

7. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 6, identity: 0.818

cctcgagt---cccggcagcgccggcgcctcgtcgg	CRISPR spacer
---cgagtgggaccggcagcgccggcgcctggtggg	Protospacer
   *****    ****************** ** **

8. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.812

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ctggccgcccggcagcgccggcgccgcttcgg	Protospacer
** *   ****************** * ****

9. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

---ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gagctcg---cccagcagcgccagcgcctcgtccg	Protospacer
   ****   ***.********.********** *

10. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

---ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gagctcg---cccagcagcgccagcgcctcgtccg	Protospacer
   ****   ***.********.********** *

11. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 6, identity: 0.812

ctcgagt---cccggcagcgccggcgcctcgtcgg	CRISPR spacer
---gagtgggaccggcagcgccggcgcctggtggg	Protospacer
   ****    ****************** ** **

12. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

---ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gagctcg---cccagcagcgccagcgcctcgtccg	Protospacer
   ****   ***.********.********** *

13. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

---ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gagctcg---cccagcagcgccagcgcctcgtccg	Protospacer
   ****   ***.********.********** *

14. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

---ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gagctcg---cccagcagcgccagcgcctcgtccg	Protospacer
   ****   ***.********.********** *

15. spacer 3.16|3236392|32|CP029553|CRISPRCasFinder,CRT matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 6, identity: 0.812

tccgggtccgcggcgaggttggaccgcagctt	CRISPR spacer
tcgccgtccgcggcgagcttggtccgcagctg	Protospacer
**   ************ **** ********

16. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to MF324907 (Arthrobacter phage Beans, complete genome) position: , mismatch: 6, identity: 0.812

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagacgcagcgggcc	Protospacer
 * *** ..******************* ***

17. spacer 4.21|3388712|33|CP029553|PILER-CR matches to MF324907 (Arthrobacter phage Beans, complete genome) position: , mismatch: 6, identity: 0.818

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagacgcagcgggccg	Protospacer
 * *** ..******************* ****

18. spacer 5.7|3647881|33|CP029553|PILER-CR matches to KU998238 (Gordonia phage Splinter, complete genome) position: , mismatch: 6, identity: 0.818

cgtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
ctggtccgtgtcgtgcttcgccgccttggcgac	Protospacer
*  **   ****** ******************

19. spacer 5.7|3647881|33|CP029553|PILER-CR matches to NC_030911 (Gordonia phage Vendetta, complete genome) position: , mismatch: 6, identity: 0.818

cgtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
ctggtccgtgtcgtgcttcgccgccttggcgac	Protospacer
*  **   ****** ******************

20. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

21. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

22. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

23. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

24. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

25. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

26. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

27. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

28. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

29. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

30. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

31. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

32. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.818

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
*** . *.**************.***.******

33. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to KU998238 (Gordonia phage Splinter, complete genome) position: , mismatch: 6, identity: 0.812

gtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
tggtccgtgtcgtgcttcgccgccttggcgac	Protospacer
  **   ****** ******************

34. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to NC_030911 (Gordonia phage Vendetta, complete genome) position: , mismatch: 6, identity: 0.812

gtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
tggtccgtgtcgtgcttcgccgccttggcgac	Protospacer
  **   ****** ******************

35. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP025014 (Rhizobium leguminosarum strain Norway plasmid pRLN2, complete sequence) position: , mismatch: 6, identity: 0.812

gtgtcggccctgacgacgctcggcgc-cacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgctcatcc-	Protospacer
* .****** * ************** **.**

36. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP025508 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvB, complete sequence) position: , mismatch: 6, identity: 0.812

gtgtcggccctgacgacgctcggcgc-cacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgctcatcc-	Protospacer
* .****** * ************** **.**

37. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022667 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR2, complete sequence) position: , mismatch: 6, identity: 0.812

gtgtcggccctgacgacgctcggcgc-cacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgctcatcc-	Protospacer
* .****** * ************** **.**

38. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050087 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b5, complete sequence) position: , mismatch: 6, identity: 0.812

gtgtcggccctgacgacgctcggcgc-cacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgctcatcc-	Protospacer
* .****** * ************** **.**

39. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

40. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

41. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

42. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

43. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

44. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

45. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

46. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

47. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

48. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

49. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

50. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

51. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tgctgggcctcttcgagcgtgtccgcgccgtc	Protospacer
** . *.**************.***.******

52. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

tggccgacctcttcgagcgtgcccgtgccgtc-	CRISPR spacer
tggccgacctcatcgtgcgtg-ccgggcagccg	Protospacer
*********** *** ***** *** ** *.*

53. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024314 (Rhizobium sp. NXC24 plasmid pRspNXC24c, complete sequence) position: , mismatch: 6, identity: 0.812

cctccgaccacgccgatgatgccgccaagcca-	CRISPR spacer
tttccgaaaacgccgatgatgccg-catgccaa	Protospacer
..*****  *************** ** ****

54. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_025031 (Bacterium enrichment culture clone 2a(2010) plasmid hyperthermophilic bacterial plasmid 2a, complete sequence) position: , mismatch: 6, identity: 0.812

cacgcatccaggccggcgacgccg--gagcggaa	CRISPR spacer
aacgcatccaggtcggcaacgccgtcgagctg--	Protospacer
 ***********.****.******  **** *

55. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NC_009475 (Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence) position: , mismatch: 6, identity: 0.812

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcgg---	Protospacer
 ******** ***************   ***

56. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022370 (Bosea sp. AS-1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcgg---	Protospacer
 ******** ***************   ***

57. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022370 (Bosea sp. AS-1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.812

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcgg---	Protospacer
 ******** ***************   ***

58. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.812

cgataggtgtcctggtcctcgatcagcgtgtc-	CRISPR spacer
ggataggtgacctggtcctcgacca-cttgtgg	Protospacer
 ******** ************.** * ***

59. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.818

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctg	Protospacer
*. *********.****************   *

60. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 6, identity: 0.818

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctg	Protospacer
*. *********.****************   *

61. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 6, identity: 0.818

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctg	Protospacer
*. *********.****************   *

62. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 6, identity: 0.818

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctg	Protospacer
*. *********.****************   *

63. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NC_009475 (Bradyrhizobium sp. BTAi1 plasmid pBBta01, complete sequence) position: , mismatch: 6, identity: 0.824

cgataggtgtcctggtcctcgatcagc-gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcggcg-	Protospacer
 ******** *************** * *.* **

64. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP022370 (Bosea sp. AS-1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cgataggtgtcctggtcctcgatcagc-gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcggcg-	Protospacer
 ******** *************** * *.* **

65. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP022370 (Bosea sp. AS-1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.824

cgataggtgtcctggtcctcgatcagc-gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgatcacctgcggcg-	Protospacer
 ******** *************** * *.* **

66. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 6, identity: 0.824

cgataggtgtcctggtcctcgatcagcgtgtcgg-	CRISPR spacer
ggataggtgacctggtcctcgacca-cttgtgggg	Protospacer
 ******** ************.** * *** **

67. spacer 3.7|3236391|33|CP029553|PILER-CR matches to LN997845 (Streptomyces reticuli genome assembly TUE45, plasmid : IV) position: , mismatch: 7, identity: 0.788

gtccgggtccgcggcgaggttggaccgcagctt	CRISPR spacer
ctcgccgtccgcggcgagcttggtccgcagctg	Protospacer
 **   ************ **** ********

68. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 7, identity: 0.781

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
** .*** *********** ********. *

69. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 7, identity: 0.781

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
** .*** *********** ********. *

70. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 7, identity: 0.781

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ctccttgccgggcagcggcggcgcctcgtcgt	Protospacer
***    ** ******* *************

71. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 7, identity: 0.781

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
** .*** *********** ********. *

72. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016082 (Streptomyces sp. SAT1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.781

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cccgacgaccggcagcgccgccgcctcgacgt	Protospacer
*.***   ************ ******* **

73. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 7, identity: 0.781

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
tgcccgatcgggatcgtcggcctgccgcgccg	Protospacer
* ***************** ***** **

74. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023549 (Rhodobacter sp. CZR27 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

ttcccgatcgggatcgtcgtcctgc-agccggt	CRISPR spacer
ggcccggtcgagatcgtcgtcctgctcgccag-	Protospacer
  ****.***.**************  ***.*

75. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 7, identity: 0.781

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
gcaaagatcgccaggcgcagcatgacgcgcac	Protospacer
 * *.****** ************.*****..

76. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to MT776811 (Arthrobacter phage King2, complete genome) position: , mismatch: 7, identity: 0.781

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggcc	Protospacer
 * *** ..*********** ******* ***

77. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to NC_041931 (Arthrobacter phage Jawnski, complete genome) position: , mismatch: 7, identity: 0.781

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggcc	Protospacer
 * *** ..*********** ******* ***

78. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to NC_042014 (Arthrobacter phage Piccoletto, complete genome) position: , mismatch: 7, identity: 0.781

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggcc	Protospacer
 * *** ..*********** ******* ***

79. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to MF377442 (Arthrobacter phage Franzy, complete genome) position: , mismatch: 7, identity: 0.781

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggcc	Protospacer
 * *** ..*********** ******* ***

80. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to NC_041930 (Arthrobacter phage Brent, complete genome) position: , mismatch: 7, identity: 0.781

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggcc	Protospacer
 * *** ..*********** ******* ***

81. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.781

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
gccgcgtcgggctggcccatgcccgcctcagc	Protospacer
*  *************** *******  *  *

82. spacer 4.13|3388224|33|CP029553|PILER-CR matches to NZ_LR594663 (Variovorax sp. RA8 plasmid 2) position: , mismatch: 7, identity: 0.788

tccaggatcgcgaggcgcagcatggcgcgcgtg	CRISPR spacer
gcaaagatcgccaggcgcagcatgacgcgcacg	Protospacer
 * *.****** ************.*****..*

83. spacer 4.20|3388651|33|CP029553|PILER-CR matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.788

cgcccgcgatgtatgacggcccggtgagtccgc---	CRISPR spacer
accccgcgatgtatgacagcccgctg---ccgcagg	Protospacer
  ***************.***** **   ****

84. spacer 4.21|3388712|33|CP029553|PILER-CR matches to MT776811 (Arthrobacter phage King2, complete genome) position: , mismatch: 7, identity: 0.788

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggccg	Protospacer
 * *** ..*********** ******* ****

85. spacer 4.21|3388712|33|CP029553|PILER-CR matches to NC_041931 (Arthrobacter phage Jawnski, complete genome) position: , mismatch: 7, identity: 0.788

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggccg	Protospacer
 * *** ..*********** ******* ****

86. spacer 4.21|3388712|33|CP029553|PILER-CR matches to NC_042014 (Arthrobacter phage Piccoletto, complete genome) position: , mismatch: 7, identity: 0.788

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggccg	Protospacer
 * *** ..*********** ******* ****

87. spacer 4.21|3388712|33|CP029553|PILER-CR matches to MF377442 (Arthrobacter phage Franzy, complete genome) position: , mismatch: 7, identity: 0.788

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggccg	Protospacer
 * *** ..*********** ******* ****

88. spacer 4.21|3388712|33|CP029553|PILER-CR matches to NC_041930 (Arthrobacter phage Brent, complete genome) position: , mismatch: 7, identity: 0.788

cgatgcgtaggctgtccgagacgcagcgcgccg	CRISPR spacer
agctgctcgggctgtccgagtcgcagcgggccg	Protospacer
 * *** ..*********** ******* ****

89. spacer 4.22|3388773|33|CP029553|PILER-CR matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 7, identity: 0.788

gaggcgtcgggctggcccttgcccgcggcctcg---	CRISPR spacer
gagacgtcgggctggcccttggccatg---tcgaat	Protospacer
***.***************** **..*   ***

90. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.788

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
ctcgggcacctcgtcgagcgtgcccgtgacgac	Protospacer
** *   ***** *************** ** *

91. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 7, identity: 0.781

gtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
ggcttgatgtcgtccttcgtcgccttgccgaa	Protospacer
*  * * ************.******* ***

92. spacer 5.28|3647943|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.781

--tcggcggctatcgcgtgctgctgacctggatc	CRISPR spacer
tgccgacg--catcgcatgctgccgacctggatc	Protospacer
  .**.**  .*****.******.**********

93. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021029 (Rhizobium sp. TAL182 plasmid pRetTAL182e, complete sequence) position: , mismatch: 7, identity: 0.781

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtagaggccctgaaggcgctcggcgccaggcg	Protospacer
**.  ******** *.************  **

94. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 7, identity: 0.781

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gcggccgtgctgaagacgctcggcgccacgcg	Protospacer
*.* * *. **** *************** **

95. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014600 (Yangia sp. CCB-MM3 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.781

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tcgggcacctcgtcgagcgtgcccgtgacgac	Protospacer
* *   ***** *************** ** *

96. spacer 5.35|3648370|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029777 (Deinococcus actinosclerus strain Deinococcus actinosclerus SJTR plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

-ctcgcgacgctcacggccttcggggcgacccg	CRISPR spacer
agccgc-acgctcacggccgtcgggtcgacgcc	Protospacer
  .*** ************ ***** **** *

97. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
gcggcctcggcgatcgcgtcggtcgcggcgga	Protospacer
  **.******************* **.* *

98. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
cgcgcagcggctatcgcgtcggtcacgaccgc	Protospacer
*. *.  **** ************ *******

99. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MN813686 (Mycobacterium phage BirdsNest, complete genome) position: , mismatch: 7, identity: 0.781

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ccggtgaacacgccgatgatgccgcccagcag	Protospacer
**  .** ****************** *** .

100. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014310 (Burkholderia sp. PAMC 26561 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.781

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ccatcgatcacgccgatgatgtcgccaatctg	Protospacer
** .***.*************.****** *..

101. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 7, identity: 0.781

cacgcatcc---aggccggcgacgccggagcggaa	CRISPR spacer
---gcgcccgcgaggccggcgatgccggagccgaa	Protospacer
   **..**   **********.******** ***

102. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007214 (Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence) position: , mismatch: 7, identity: 0.781

---cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
ggccacg---ccaggccggcgacgaaggagcggcc	Protospacer
   ****   **************  *******

103. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007214 (Burkholderia plantarii strain ATCC 43733 plasmid bpln_1p, complete sequence) position: , mismatch: 7, identity: 0.781

---cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
ggccacg---ccaggccggcgacgaaggagcggcc	Protospacer
   ****   **************  *******

104. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP011667 (Streptomyces sp. Mg1 plasmid pSMg1-3, complete sequence) position: , mismatch: 7, identity: 0.781

cacg-catccaggccggcgacgccggagcggaa	CRISPR spacer
-acgtcgcccagggcggcgacgccggcgcggtg	Protospacer
 *** *..***** ************ **** .

105. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacggcccgtt--	CRISPR spacer
ggcctgccgctggccgccggctacg--tcgtcag	Protospacer
 ********* ***** ********  .***.

106. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

107. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

108. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

109. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

110. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

111. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

112. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

113. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

114. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

115. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

116. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

117. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

118. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

119. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

120. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

121. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

122. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

123. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

124. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

125. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

126. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

127. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

128. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

129. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

130. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

131. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctgccgcgggccgacggctacg---gcccgtt	CRISPR spacer
atcctgccgcaggccgacggcaacgcgcgccc---	Protospacer
  ********.********** ***   ****

132. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NC_019846 (Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

133. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NC_007960 (Nitrobacter hamburgensis X14 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctgatcctcgatcacttgcgg---	Protospacer
 ******** ****.**********   ***

134. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021826 (Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

135. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP044544 (Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacttggtcctcgatcacttgcgg---	Protospacer
 ******** *.*************   ***

136. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021832 (Sinorhizobium meliloti strain HM006 plasmid accessoryA, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

137. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

138. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP026529 (Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

139. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP039909 (Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

140. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.781

cgataggtgtcctggtcctcgatca---gcgtgtc	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcgg---	Protospacer
 ******** ************.**   ***

141. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NC_007960 (Nitrobacter hamburgensis X14 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.794

cgataggtgtcctggtcctcgatcagcgtgtcgg-	CRISPR spacer
ggataggtgacctgatcctcgatca-cttgcgggg	Protospacer
 ******** ****.********** * **. **

142. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.794

cgataggtgtcctggtcctcgatcagc-gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggcg-	Protospacer
 ******** ************.** * *.* **

143. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP050083 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b3, complete sequence) position: , mismatch: 8, identity: 0.758

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
 ** .*** *********** ********. *

144. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP049733 (Rhizobium leguminosarum strain A1 plasmid pRL10, complete sequence) position: , mismatch: 8, identity: 0.758

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
 ** .*** *********** ********. *

145. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP020952 (Rhizobium sp. CIAT894 plasmid pRheCIAT894e, complete sequence) position: , mismatch: 8, identity: 0.758

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gctccttgccgggcagcggcggcgcctcgtcgt	Protospacer
 ***    ** ******* *************

146. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 8, identity: 0.758

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ccgcatagaccggcaccgtcggcgcctcgtcgg	Protospacer
** *. .  ****** **.**************

147. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP053207 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1C, complete sequence) position: , mismatch: 8, identity: 0.758

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gctgaagtgccggcagcgcctgcgcctcgcggt	Protospacer
 ** .*** *********** ********. *

148. spacer 3.3|3236147|33|CP029553|PILER-CR matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.758

cgaggcgatgccgcgggacagcatccggtcccg	CRISPR spacer
cccgtccatgccgccgggcagcatccggtccac	Protospacer
*  * * ******* **.*************

149. spacer 3.3|3236147|33|CP029553|PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

--cgaggcgatgccgcgggacagcatccggtcccg	CRISPR spacer
gtctag--catgccgcgggagagcatccgttccga	Protospacer
  * **   *********** ******** *** .

150. spacer 3.4|3236208|33|CP029553|PILER-CR matches to NZ_CP009155 (Burkholderia pseudomallei strain TSV202 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.758

caggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
cgacgctcgatgtgccgacgcagtcgatttcca	Protospacer
*.. ..*********** *** ********* *

151. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023738 (Methylosinus trichosporium OB3b plasmid pOB3b1, complete sequence) position: , mismatch: 8, identity: 0.75

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ttgccgcgccggcagcgctggcgcctcgtcga	Protospacer
.*   *. **********.************.

152. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 8, identity: 0.75

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cgaaaagcccggcagcgccggcgccatgtcga	Protospacer
*  .*. ****************** .****.

153. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053022 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-A-Sy, complete sequence) position: , mismatch: 8, identity: 0.75

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cgcatagaccggcaccgtcggcgcctcgtcgg	Protospacer
* *. .  ****** **.**************

154. spacer 3.12|3236148|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 8, identity: 0.75

gaggcgatgccgcgggacagcatccggtcccg	CRISPR spacer
ccgtccatgccgccgggcagcatccggtccac	Protospacer
  * * ******* **.*************

155. spacer 3.12|3236148|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015040 (Rhodovulum sp. P5 plasmid pRGUI01, complete sequence) position: , mismatch: 8, identity: 0.75

gaggcgatgccgcgggacagcatccggtcccg	CRISPR spacer
gagaaatagctgcgggacagcatcctgtccca	Protospacer
***. .  **.************** *****.

156. spacer 3.13|3236209|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP009155 (Burkholderia pseudomallei strain TSV202 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

aggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
gacgctcgatgtgccgacgcagtcgatttcca	Protospacer
.. ..*********** *** ********* *

157. spacer 3.13|3236209|32|CP029553|CRISPRCasFinder,CRT matches to MN813682 (Microbacterium phage Matzah, complete genome) position: , mismatch: 8, identity: 0.75

aggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
cgacttcgacgtgccgcccctgtcgatgtggc	Protospacer
 *. *****.******** ******** * *

158. spacer 3.13|3236209|32|CP029553|CRISPRCasFinder,CRT matches to MK937591 (Microbacterium phage Cinna, complete genome) position: , mismatch: 8, identity: 0.75

aggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
cgacttcgacgtgccgcccctgtcgatgtggc	Protospacer
 *. *****.******** ******** * *

159. spacer 3.16|3236392|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tccgggtccgcggcgaggttggaccgcagctt	CRISPR spacer
cgcgattccgcggcgatgttggagcgcagatc	Protospacer
. **. ********** ****** ***** *.

160. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020716 (Cnuibacter physcomitrellae strain XA(T) plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
atcgcgatcgggatcgtcgtcgtgtcggtcgt	Protospacer
 ** ***************** **. * . **

161. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
agcaggatcgcgagcggcagcatggcgtcgct	Protospacer
  ************  ***********.   *

162. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 8, identity: 0.75

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
gtcaggatggcgaggcgcagcagggtggtcga	Protospacer
 .****** ************* **.*  **

163. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013265 (Sphingobium baderi strain DE-13 plasmid pDE1, complete sequence) position: , mismatch: 8, identity: 0.75

---tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
gcggcttgg---gcgaggcgcagcttggcgggcgt	Protospacer
    *. **   ************ ***** ****

164. spacer 4.4|3388346|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 8, identity: 0.75

cggtcggcgtctcgggtgcggagcacggggcg	CRISPR spacer
acctcggcgtcgcgggtacggagcacgtcgca	Protospacer
   ******** *****.*********  **.

165. spacer 4.9|3388651|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 8, identity: 0.75

cgcccgcgatgtatgacggcccggtgagtccg	CRISPR spacer
accccgcgatgtatgacagcccgctgccgcag	Protospacer
  ***************.***** **   * *

166. spacer 4.10|3388712|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022339 (Mameliella alba strain KU6B plasmid pKUB112, complete sequence) position: , mismatch: 8, identity: 0.75

cgatgcgtaggctgtccgagacgcagcgcgcc	CRISPR spacer
gcgtggatcggctgaccgagacgctgcgcgcc	Protospacer
  .** .* ***** ********* *******

167. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 8, identity: 0.75

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
gagacgtcgggctggcccttggccatgtcgaa	Protospacer
***.***************** **..* *

168. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013426 (Burkholderia sp. MSMB0856 plasmid pMSMB0856, complete sequence) position: , mismatch: 8, identity: 0.75

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
acgacgtcgggctggccgtcgcccgcgaggtc	Protospacer
. *.************* *.*******.  **

169. spacer 4.15|3388346|33|CP029553|PILER-CR matches to NZ_CP024940 (Paraburkholderia hospita strain mHSR1 plasmid pmHSR1_P, complete sequence) position: , mismatch: 8, identity: 0.758

cggtcggcgtctcgggtgcggagcacggggcgg	CRISPR spacer
acctcggcgtcgcgggtacggagcacgtcgcag	Protospacer
   ******** *****.*********  **.*

170. spacer 5.7|3647881|33|CP029553|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 8, identity: 0.758

cgtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
gggcttgatgtcgtccttcgtcgccttgccgaa	Protospacer
 *  * * ************.******* ***

171. spacer 5.7|3647881|33|CP029553|PILER-CR matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.758

cgtgtagct---gtcgtccttcgccgccttggcgac	CRISPR spacer
---gcggccgaggtcgcccgtcgccgccttggcgac	Protospacer
   *..**.   ****.** ****************

172. spacer 5.8|3647942|33|CP029553|PILER-CR matches to MH825712 (Microbacterium phage ValentiniPuff, complete genome) position: , mismatch: 8, identity: 0.758

ctcggcggctatcgcgtgctgctgacctggatc	CRISPR spacer
ctcggcggcaatctcgtgctgctgctcggcgtg	Protospacer
********* *** ********** .* * .*

173. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.758

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ccggtcggccctcacggcgctcggcgccctcgt	Protospacer
*  ********* ***.*********** .*

174. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.758

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctatccgaccctgacgacgctcggcgtcatgcg	Protospacer
*   .**.******************.**. **

175. spacer 5.16|3648430|33|CP029553|PILER-CR matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

ccaggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
ggcggcctcggcgatcgcgtcggtcgcggcgga	Protospacer
   **.******************* **.* *

176. spacer 5.16|3648430|33|CP029553|PILER-CR matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.758

ccaggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
gcgcgcagcggctatcgcgtcggtcacgaccgc	Protospacer
 *. *.  **** ************ *******

177. spacer 5.25|3647760|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 8, identity: 0.75

tcgggcccggggagagggccgaagccgaagga	CRISPR spacer
tcgcgcccggggagagcgccgaagtgggaccg	Protospacer
*** ************ *******. *.*  .

178. spacer 5.25|3647760|32|CP029553|CRISPRCasFinder,CRT matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 8, identity: 0.75

tcgggcccggggagagggccgaagccgaagga	CRISPR spacer
acggccccgcggagagggccgaaggaggtggc	Protospacer
 *** **** **************  *. **

179. spacer 5.25|3647760|32|CP029553|CRISPRCasFinder,CRT matches to NC_019388 (Thermus oshimai JL-2 plasmid pTHEOS02, complete sequence) position: , mismatch: 8, identity: 0.75

tcgggcccggggagagggccgaagccgaagga	CRISPR spacer
acggccccgcggagagggccgaaggaggtggc	Protospacer
 *** **** **************  *. **

180. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP018096 (Chelatococcus daeguensis strain TAD1 plasmid pTAD1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
cggccgaggtcgcccgtcgccgccttggcgac	Protospacer
  *. *  ****.** ****************

181. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtagc-tgtcgtccttcgccgccttggcgac	CRISPR spacer
-cgcaacgcatcgtcctgcgccgcctttgcgac	Protospacer
 .*.*.* ..******* ********* *****

182. spacer 5.27|3647882|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtagctgtcgtccttcgccgccttggcgac	CRISPR spacer
ttccagctgtcgtccttggccaccttgttgaa	Protospacer
 * .************* ***.***** .**

183. spacer 5.28|3647943|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP018910 (Acinetobacter pittii strain XJ88 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcggctatcgcgtgctgctgacctggatc---	CRISPR spacer
agggcggctatctcgtggtgctgac---aatcaat	Protospacer
  ********** **** *******   .***

184. spacer 5.28|3647943|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP010857 (Marinovum algicola DG 898 plasmid pMaD2, complete sequence) position: , mismatch: 8, identity: 0.75

tcggcggctatcgcgtgctgctgacctggatc	CRISPR spacer
tcggcggcaatggcgtgctgctgcgcgtcaac	Protospacer
******** ** ***********  *   * *

185. spacer 5.28|3647943|32|CP029553|CRISPRCasFinder,CRT matches to MH825712 (Microbacterium phage ValentiniPuff, complete genome) position: , mismatch: 8, identity: 0.75

tcggcggctatcgcgtgctgctgacctggatc	CRISPR spacer
tcggcggcaatctcgtgctgctgctcggcgtg	Protospacer
******** *** ********** .* * .*

186. spacer 5.29|3648004|32|CP029553|CRISPRCasFinder,CRT matches to HQ332141 (Halorubrum phage CGphi46 genomic sequence) position: , mismatch: 8, identity: 0.75

tcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
acagccgcctcgggcgcttcgatggcgaagtc	Protospacer
 *. . **************** * ******

187. spacer 5.29|3648004|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP040763 (Paracoccus sp. 2251 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

tcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
gcgctggcctcgggcgtttggaaggtgacggt	Protospacer
 ***************.** **** .** *

188. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023408 (Streptomyces fungicidicus strain TXX3120 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
cggtcggccctcacggcgctcggcgccctcgt	Protospacer
  ********* ***.*********** .*

189. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

190. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

191. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

192. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

193. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

194. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtgaccacgctcggcgcccatcc	Protospacer
* .****** **** ************  .*

195. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

196. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

197. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

198. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021814 (Sinorhizobium meliloti strain M270 plasmid psymB, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
tatccgaccctgacgacgctcggcgtcatgcg	Protospacer
   .**.******************.**. **

199. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

200. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

201. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gaatcggccgtcacgacgctcggcgcccatcc	Protospacer
* .****** * ***************  .*

202. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP040764 (Paracoccus sp. 2251 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
atcgcggtcctgaagacgctcggcgcctcggg	Protospacer
.*  ***.***** ************* *  *

203. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.75

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gggtcggccctgaggacgcccggcgatgcggg	Protospacer
* *********** *****.***** ..*  *

204. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccggcaagtcgc	CRISPR spacer
acctatctgaagctgagcgaccggcacgtcgg	Protospacer
 ***  ..******** ********* ****

205. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KT783672 (Arthrobacter phage TymAbreu, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

206. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MF140420 (Arthrobacter phage Mariposa, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

207. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576951 (Arthrobacter phage Copper, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

208. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576955 (Arthrobacter phage Hunnie, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

209. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KT355475 (Arthrobacter phage Sandman, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

210. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KX576642 (Arthrobacter phage Massimo, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

211. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KX610765 (Arthrobacter phage Prospero, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

212. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160670 (Arthrobacter phage Toulouse, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

213. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to NC_028692 (Arthrobacter phage Decurro, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

214. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MN813695 (Arthrobacter phage LouisXIV, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

215. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576950 (Arthrobacter phage CGermain, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

216. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH779506 (Arthrobacter phage Guntur, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

217. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MF140426 (Arthrobacter phage Seume, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

218. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576948 (Arthrobacter phage Azathoth, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

219. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160655 (Arthrobacter phage Maggie, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

220. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MF140417 (Arthrobacter phage Link, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

221. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KY434670 (Arthrobacter phage Chestnut, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

222. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MF140433 (Arthrobacter phage TinoCrisci, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

223. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576957 (Arthrobacter phage Inspire2, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

224. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576961 (Arthrobacter phage Ronnie, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

225. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KX443695 (Arthrobacter phage Courtney3, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

226. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160674 (Arthrobacter phage Yank, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

227. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160657 (Arthrobacter phage Moloch, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

228. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160658 (Arthrobacter phage Muttlie, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

229. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MK737943 (Arthrobacter phage Arby, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

230. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to MH576952 (Arthrobacter phage Dewayne, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

231. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KU160667 (Arthrobacter phage Stratus, complete genome) position: , mismatch: 8, identity: 0.75

ccctcgtcgaagctgaccgaccgg-caagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagctg-	Protospacer
  **.*************** *** *.**..*

232. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 8, identity: 0.75

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
cgatggacctcttcgagcgggcccgagccgca	Protospacer
.*.. ************** ***** ****.

233. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP048282 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248d, complete sequence) position: , mismatch: 8, identity: 0.75

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
tggccgacctcttcgaccttgccgccgaagac	Protospacer
**************** * ****  .*  * *

234. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to MT776811 (Arthrobacter phage King2, complete genome) position: , mismatch: 8, identity: 0.75

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
gcgccgccctctgcgagcgtgcccgcattgtc	Protospacer
  **** ***** ************....***

235. spacer 5.35|3648370|32|CP029553|CRISPRCasFinder,CRT matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

ctcgcgacgctcacggccttcggggcgacccg	CRISPR spacer
gccgcgacgctcgcggccttcggggtcgccta	Protospacer
 .**********.************. .**..

236. spacer 5.35|3648370|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 8, identity: 0.75

ctcgcgacgctcacggccttcggggcgacccg	CRISPR spacer
agtgcgacgctcaccgccttcgcggcggcact	Protospacer
  .*********** ******* ****.* *

237. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NC_020062 (Rhizobium tropici CIAT 899 plasmid pRtrCIAT899c, complete sequence) position: , mismatch: 8, identity: 0.75

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
ttgatatcggcgatcgcgtcggtatcgacggt	Protospacer
. *.* ***************** .**** *.

238. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP012748 (Paraburkholderia caribensis MBA4 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

-----cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaaagcc-----ccgcgccgatgatgccgccgagcga	Protospacer
     **     **.****************.*** *

239. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_017791 (Deinococcus gobiensis I-0 plasmid P2, complete sequence) position: , mismatch: 8, identity: 0.75

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
cctccgaccacgacgatgatgcccgcgaaaat	Protospacer
************ **********  *.*.

240. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_KY503037 (Pseudomonas fluorescens strain PC24 plasmid pPHE24, complete sequence) position: , mismatch: 8, identity: 0.75

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ccgccgaccacgccgctgatgcccgcgattct	Protospacer
** ************ *******  *.* .*

241. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_MH061177 (Pseudomonas fluorescens strain P69 plasmid pG69, complete sequence) position: , mismatch: 8, identity: 0.75

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ccgccgaccacgccgctgatgcccgcgattct	Protospacer
** ************ *******  *.* .*

242. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MF417932 (Uncultured Caudovirales phage clone 3S_12, partial genome) position: , mismatch: 8, identity: 0.75

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
gcgccgatcaggccgatgatgccgccgaagaa	Protospacer
 * ****.** ***************.*.  *

243. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_006823 (Aromatoleum aromaticum EbN1 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
ttttcatccaggcgggcgacgacggagcgaag	Protospacer
. . ********* ******* *******.*.

244. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020900 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

245. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgaccgaccaggcccgcgacgccggagaggac	Protospacer
*.  *. ******* ************ ***

246. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013526 (Rhizobium phaseoli strain R744 plasmid pRphaR744d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

247. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013556 (Rhizobium phaseoli strain N931 plasmid pRphaN931d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

248. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013562 (Rhizobium phaseoli strain N841 plasmid pRphaN841e, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

249. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013579 (Rhizobium phaseoli strain N671 plasmid pRphaN671e, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

250. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013531 (Rhizobium phaseoli strain R723 plasmid pRphaR723d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

251. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013536 (Rhizobium phaseoli strain R650 plasmid pRphaR650d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

252. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013541 (Rhizobium phaseoli strain R630 plasmid pRphaR630d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

253. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013546 (Rhizobium phaseoli strain R620 plasmid pRphaR620d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

254. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013567 (Rhizobium phaseoli strain N831 plasmid pRphaN831d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

255. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013584 (Rhizobium phaseoli strain N261 plasmid pRphaN261d, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

256. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013573 (Rhizobium phaseoli strain N771 plasmid pRphaN771e, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

257. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_010997 (Rhizobium etli CIAT 652 plasmid pC, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agcagaagcagcccggcgacgccggagaggaa	Protospacer
 .*. *  *** *************** ****

258. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
accccggccaggccggcgatgccggagccgag	Protospacer
  * *. ************.******** **.

259. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_025133 (Sphingobium wenxiniae strain JZ-1 plasmid pPBA, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgcgcatccaggccgccggcgccgggctgggc	Protospacer
*.************* **.******. .**.

260. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_008308 (Sphingomonas sp. KA1 plasmid pCAR3 DNA, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgcgcatccaggccgccggcgccgggctgggc	Protospacer
*.************* **.******. .**.

261. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_013858 (Azospirillum sp. B510 plasmid pAB510d, complete sequence) position: , mismatch: 8, identity: 0.75

-cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
ccataga-ccagggcggcgacgtcggagcggtc	Protospacer
 **.. * ***** ********.********

262. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053023 (Sphingobium yanoikuyae strain YC-XJ2 plasmid p-B-Sy, complete sequence) position: , mismatch: 8, identity: 0.75

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgcgcatccaggccgccggcgccgggctgggc	Protospacer
*.************* **.******. .**.

263. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022994 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN4, complete sequence) position: , mismatch: 8, identity: 0.75

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
cgagggaagcgggccggcagctacggcccgtt	Protospacer
.*   *  ********.*.*************

264. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024583 (Roseomonas sp. FDAARGOS_362 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.75

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
ggcctgctgcgggcctacggctacgccgtggc	Protospacer
 ******.******* ********* * .* .

265. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP026110 (Paraburkholderia hospita strain DSM 17164 plasmid pEMT1, complete sequence) position: , mismatch: 8, identity: 0.75

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
cgagggaagcgggccggcagctacggcccgtt	Protospacer
.*   *  ********.*.*************

266. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.75

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
ggcgggccgctgtccgacggctacggccggcg	Protospacer
 **  ***** * *************** *.

267. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.75

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
ggcgggccgctgtccgacggctacggccggcg	Protospacer
 **  ***** * *************** *.

268. spacer 5.45|3648991|32|CP029553|CRISPRCasFinder,CRT matches to MK686071 (Streptomyces phage Mischief19, complete genome) position: , mismatch: 8, identity: 0.75

gcgtggctcggccagacgctcgacatgcttaa	CRISPR spacer
catctgctcggcgagacgctcgacatgctcga	Protospacer
   . ******* ****************..*

269. spacer 5.45|3648991|32|CP029553|CRISPRCasFinder,CRT matches to MH825712 (Microbacterium phage ValentiniPuff, complete genome) position: , mismatch: 8, identity: 0.75

gcgtggctcggccagacgctcgacatgcttaa	CRISPR spacer
tcagagctcggcccgaagctcgacatgctcga	Protospacer
 *. .******** ** ************..*

270. spacer 5.48|3649174|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.75

gccgtgttcttcgcggtgtccac---ctggatcta	CRISPR spacer
gcggtggtcttcgcggtgtccacacgcggggc---	Protospacer
** *** ****************   * **..

271. spacer 5.48|3649174|32|CP029553|CRISPRCasFinder,CRT matches to MN693799 (Marine virus AFVG_250M1075, complete genome) position: , mismatch: 8, identity: 0.75

gccgtgttcttcgcggtgtccacctggatcta	CRISPR spacer
ggggtgttcatcgcggcgtccacctgcgcctg	Protospacer
*  ****** ******.********* ..**.

272. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP044544 (Bradyrhizobium betae strain PL7HG1 plasmid pBbPL7HG1, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatca-gcgtgtcgg	CRISPR spacer
ggataggtgacttggtcctcgatcacttgcggcg-	Protospacer
 ******** *.*************  .*.* **

273. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP021796 (Sinorhizobium meliloti strain USDA1157 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagc----gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggtg----	Protospacer
 ******** ************.** *    ***

274. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NC_019846 (Sinorhizobium meliloti GR4 plasmid pRmeGR4a, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagc----gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggtg----	Protospacer
 ******** ************.** *    ***

275. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP021826 (Sinorhizobium meliloti strain KH35c plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagc----gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggtg----	Protospacer
 ******** ************.** *    ***

276. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP021832 (Sinorhizobium meliloti strain HM006 plasmid accessoryA, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagc----gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggtg----	Protospacer
 ******** ************.** *    ***

277. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP026529 (Sinorhizobium meliloti strain AK21 plasmid pSmeAK21b, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagc----gtgtcgg	CRISPR spacer
ggataggtgacctggtcctcgaccacctgcggtg----	Protospacer
 ******** ************.** *    ***

278. spacer 5.51|3648930|34|CP029553|PILER-CR matches to NZ_CP039909 (Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagcgtgtcgg-	CRISPR spacer
ggataggtgacctggtcctcgacca-cctgcggag	Protospacer
 ******** ************.** * **. *.

279. spacer 5.51|3648930|34|CP029553|PILER-CR matches to MH588544 (Caulobacter phage CcrBL10, complete genome) position: , mismatch: 8, identity: 0.765

cgataggtgtcctggtcctcgatcagcgtgtcgg	CRISPR spacer
aggtcgatctcctggtcctcggtcagcgtgccgc	Protospacer
 *.* *.* ************.********.**

280. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NZ_CP013110 (Sinorhizobium americanum strain CFNEI 73 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.771

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctgat	Protospacer
*. *********.****************   *..

281. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 8, identity: 0.771

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctgat	Protospacer
*. *********.****************   *..

282. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 8, identity: 0.771

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctgat	Protospacer
*. *********.****************   *..

283. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 8, identity: 0.771

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
ctcgtttgccgctgcgatcgcttcgacgatctgat	Protospacer
*. *********.****************   *..

284. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NC_031004 (Gordonia phage Nyceirae, complete genome) position: , mismatch: 8, identity: 0.771

ccggtttgccgccgcgatcgcttcgacgaaggggc----	CRISPR spacer
tcggttcgccgcctcgatcgcttcg----aggtgcttgg	Protospacer
.*****.****** ***********    *** **

285. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_LN832562 (Paracoccus aminovorans isolate JCM7685 plasmid IV, complete sequence) position: , mismatch: 9, identity: 0.727

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gcgaaaagcccggcagcgccggcgccatgtcga	Protospacer
 *  .*. ****************** .****.

286. spacer 3.1|3236025|33|CP029553|PILER-CR matches to NZ_CP039909 (Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence) position: , mismatch: 9, identity: 0.727

cctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cggcatagaccggcaccgtcggcgcctcgtcgg	Protospacer
*  *. .  ****** **.**************

287. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP039909 (Agrobacterium tumefaciens strain CFBP6624 plasmid pAtCFBP6624, complete sequence) position: , mismatch: 9, identity: 0.719

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ggcatagaccggcaccgtcggcgcctcgtcgg	Protospacer
  *. .  ****** **.**************

288. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023037 (Komagataeibacter saccharivorans strain CV1 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
tgaaggtagcggcagcgcctgcgccccgtcgg	Protospacer
.  ..**  ********** *****.******

289. spacer 3.11|3236087|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP018442 (Undibacterium sp. YM2 plasmid pUYM01, complete sequence) position: , mismatch: 9, identity: 0.719

ctgagtcatggatcgtcgtgtccgtgtcggct	CRISPR spacer
gcgacgtatggatcgtcgtgcccgtttcgggc	Protospacer
 .**  .*************.**** **** .

290. spacer 3.13|3236209|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP043508 (Acetobacter sp. KACC 21233 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

aggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
tgagctagatgtgccgccgatgtcgttttccc	Protospacer
 *...* ************ ***** ****

291. spacer 3.16|3236392|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014580 (Burkholderia sp. RPE67 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

tccgggtccgcggcgaggttggaccgcagctt	CRISPR spacer
cgtgcctccgcggcgatgttggagcgcaggtc	Protospacer
. .*  ********** ****** ***** *.

292. spacer 3.16|3236392|32|CP029553|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.719

tccgggtccgcggcgaggttggaccgcagctt	CRISPR spacer
cgtgcctccgcggcgatgttggagcgcaggtc	Protospacer
. .*  ********** ****** ***** *.

293. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
gcgcgcatcgggatcgtagtcccgcagccatt	Protospacer
 . *  *********** ****.******. *

294. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
gcgcgcatcgggatcgtagtcccgcagccatt	Protospacer
 . *  *********** ****.******. *

295. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP006991 (Rhizobium sp. IE4771 plasmid pRetIE4771e, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
tccccgatcgggatcgttggcctgccttcctc	Protospacer
*.***************.* *****  .*  .

296. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP021128 (Rhizobium sp. Kim5 plasmid pRetKim5d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
tccccgatcgggatcgttggcctgccttcctc	Protospacer
*.***************.* *****  .*  .

297. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to CP007645 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803d, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
tccccgatcgggatcgttggcctgccttcctc	Protospacer
*.***************.* *****  .*  .

298. spacer 3.19|3236576|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

ttcccgatcgggatcgtcgtcctgcagccggt	CRISPR spacer
gcgctggccgggatcgtcttcctgctgccggc	Protospacer
 . *.*..********** ****** *****.

299. spacer 4.1|3388163|32|CP029553|CRISPRCasFinder,CRT matches to NC_011961 (Thermomicrobium roseum DSM 5159 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

accgcaacgcggatcctcgaccggtccgtgat	CRISPR spacer
ctggcgaggcggatcctcgaccggtcgcggtt	Protospacer
 . **.* ******************   * *

300. spacer 4.1|3388163|32|CP029553|CRISPRCasFinder,CRT matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 9, identity: 0.719

----accgcaacgcggatcctcgaccggtccgtgat	CRISPR spacer
gagcattgt----cggatcctcgaccgatccatgat	Protospacer
    *..*.    **************.***.****

301. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 9, identity: 0.719

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
atcccgatcgcgaaccgcagcatggcgcggcc	Protospacer
 .*  ********. **************  .

302. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050084 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b2, complete sequence) position: , mismatch: 9, identity: 0.719

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
tccaggatcacgaagcgcagcatcaagaaggg	Protospacer
*********.***.********* . * . *

303. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053209 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1A, complete sequence) position: , mismatch: 9, identity: 0.719

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
tccaggatcacgaagcgcagcatcaagaaggg	Protospacer
*********.***.********* . * . *

304. spacer 4.4|3388346|32|CP029553|CRISPRCasFinder,CRT matches to NC_048021 (Gordonia phage Daredevil, complete genome) position: , mismatch: 9, identity: 0.719

cggtcggcgtctcgggtgcggagcacggggcg	CRISPR spacer
cggccggcgtctcgggtgcggtgccgttgttc	Protospacer
***.***************** **    * .

305. spacer 4.9|3388651|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050092 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b6, complete sequence) position: , mismatch: 9, identity: 0.719

cgcccgcgatgtatgacggcccggtgagtccg	CRISPR spacer
gcagcgcggtgaatgacggcccggtgaaaacg	Protospacer
    ****.** ***************.  **

306. spacer 4.9|3388651|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016287 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cgcccgcgatgtatgacggcccggtgagtccg	CRISPR spacer
gcagcgcggtgaatgacggcccggtgaaaacg	Protospacer
    ****.** ***************.  **

307. spacer 4.9|3388651|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022565 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK01, complete sequence) position: , mismatch: 9, identity: 0.719

cgcccgcgatgtatgacggcccggtgagtccg	CRISPR spacer
gcagcgcggtgaatgacggcccggtgaaaacg	Protospacer
    ****.** ***************.  **

308. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
cggccgtcgggctggaccttccccgcggggaa	Protospacer
 .* *********** **** *******

309. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 9, identity: 0.719

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
cgcgcgtcgagcgggcccttgcccgcataccc	Protospacer
 . ******.** *************.  *.*

310. spacer 4.12|3388163|33|CP029553|PILER-CR matches to NC_007766 (Rhizobium etli CFN 42 plasmid p42f, complete sequence) position: , mismatch: 9, identity: 0.727

----accgcaacgcggatcctcgaccggtccgtgatg	CRISPR spacer
gagcattgt----cggatcctcgaccgatccatgatg	Protospacer
    *..*.    **************.***.*****

311. spacer 4.13|3388224|33|CP029553|PILER-CR matches to NZ_CP030127 (Indioceanicola profundi strain SCSIO 08040 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

tccaggatcgcgaggcgcagcatggcgcgcgtg	CRISPR spacer
agcaggatcgcgagcggcagcatggcgtcgcta	Protospacer
  ************  ***********.   *.

312. spacer 4.13|3388224|33|CP029553|PILER-CR matches to NZ_LR134450 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 8, complete sequence) position: , mismatch: 9, identity: 0.727

tccaggatcgcgaggcgcagcatggcgcgcgtg	CRISPR spacer
atcccgatcgcgaaccgcagcatggcgcggccg	Protospacer
 .*  ********. **************  .*

313. spacer 4.22|3388773|33|CP029553|PILER-CR matches to NZ_CP034811 (Paracoccus sp. Arc7-R13 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.727

gaggcgtcgggctggcccttgcccgcggcctcg	CRISPR spacer
cggccgtcgggctggaccttccccgcggggaag	Protospacer
 .* *********** **** *******    *

314. spacer 5.5|3647759|33|CP029553|PILER-CR matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 9, identity: 0.727

gtcgggcccggggagagggccgaagccgaagga	CRISPR spacer
atcgcgcccggggagagcgccgaagtgggaccg	Protospacer
.*** ************ *******. *.*  .

315. spacer 5.9|3648003|33|CP029553|PILER-CR matches to HQ332141 (Halorubrum phage CGphi46 genomic sequence) position: , mismatch: 9, identity: 0.727

ctcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
gacagccgcctcgggcgcttcgatggcgaagtc	Protospacer
  *. . **************** * ******

316. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP018230 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

317. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP016289 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

318. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP023000 (Rhizobium sp. 11515TR strain 10195 plasmid p11515TR-B, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtgaccacgctcggcgcccatcc	Protospacer
 * .****** **** ************  .*

319. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP022566 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK02, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

320. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

321. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP050105 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b6, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
agaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

322. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP049732 (Rhizobium leguminosarum strain A1 plasmid pRL11, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

323. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP050110 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b4, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
agaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

324. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP030764 (Rhizobium leguminosarum strain ATCC 14479 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

325. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

326. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

327. spacer 5.10|3648064|33|CP029553|PILER-CR matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.727

cgtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ggaatcggccgtcacgacgctcggcgcccatcc	Protospacer
 * .****** * ***************  .*

328. spacer 5.14|3648308|33|CP029553|PILER-CR matches to NZ_CP032676 (Rhodococcus rhodochrous strain ATCC BAA870 plasmid pNit, complete sequence) position: , mismatch: 9, identity: 0.727

ctggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
gcgatggacctcttcgagcgggcccgagccgca	Protospacer
 .*.. ************** ***** ****.

329. spacer 5.15|3648369|33|CP029553|PILER-CR matches to NZ_AP014706 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_2p, complete sequence) position: , mismatch: 9, identity: 0.727

cctcgcgacgctcacggccttcggggcgacccg	CRISPR spacer
gagtgcgacgctcaccgccttcgcggcggcact	Protospacer
   .*********** ******* ****.* *

330. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to MT708548 (Streptomyces phage Salutena, complete genome) position: , mismatch: 9, identity: 0.719

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
tcgcgctgcgggaaggacgggaaggcggccac	Protospacer
. .. *.***** ***.************* *

331. spacer 5.25|3647760|32|CP029553|CRISPRCasFinder,CRT matches to CP040467 (Streptomyces albidoflavus strain UYFA156 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

tcgggcccggggagagggccgaagccgaagga	CRISPR spacer
aagggccaggggagggggccgaagcaacggca	Protospacer
  ***** ******.********** . .* *

332. spacer 5.29|3648004|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP054603 (Sulfitobacter pseudonitzschiae strain H46 plasmid unnamed4, complete sequence) position: , mismatch: 9, identity: 0.719

tcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
tgcttggcctctggcgctacgaagtcgcacag	Protospacer
*  .******* ****** ******** *  .

333. spacer 5.29|3648004|32|CP029553|CRISPRCasFinder,CRT matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 9, identity: 0.719

tcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
acgctggcttcgggcgctccgaagccagctga	Protospacer
 *******.*********.*****.*..   *

334. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP018001 (Rhizobium sp. Y9 plasmid pY9, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtcagggccctgacggcgctctgcgccaggat	Protospacer
**   **********.***** ******

335. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gccgtgaccctgacgacgttcggcaccaccac	Protospacer
*.  .*.***********.*****.*****

336. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NC_022536 (Rhizobium sp. IRBG74 plasmid IRBL74_p, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtcagggccctgacggcgctctgcgccaggat	Protospacer
**   **********.***** ******

337. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP039913 (Agrobacterium tumefaciens strain CFBP6625 plasmid pAtCFBP6625b, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtcagggccctgacggcgctctgcgccaggat	Protospacer
**   **********.***** ******

338. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctcgaaggcctgcagacgctcggcgccaccct	Protospacer
 *   .* ****  *****************

339. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to CP036360 (Agrobacterium sp. 33MFTa1.1 plasmid p_JBx_073812, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtcagggccctgacggcgctctgcgccaggat	Protospacer
**   **********.***** ******

340. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctcgaaggcctgcagacgctcggcgccaccct	Protospacer
 *   .* ****  *****************

341. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

ccctcgtcgaagctgaccgaccggcaagtcgc	CRISPR spacer
ggcgtctggaatctgaccgacccgcaagtcga	Protospacer
  * . * *** ********** ********

342. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to NC_009468 (Acidiphilium cryptum JF-5 plasmid pACRY02, complete sequence) position: , mismatch: 9, identity: 0.719

ccctcgtcgaagctgaccgaccggcaagtcgc	CRISPR spacer
gatccggagatgctgaccgaccggcaggtcga	Protospacer
  ..**  ** ***************.****

343. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP006369 (Aureimonas sp. AU20 plasmid pAU20b, complete sequence) position: , mismatch: 9, identity: 0.719

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
gcgtaggtgtcttccagcgtgcccttgccgtc	Protospacer
  *. *.. ***** ********* *******

344. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP009294 (Novosphingobium pentaromativorans US6-1 plasmid pLA1, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
gatgcgccggcgatcgggtcggtcctgaccag	Protospacer
 * *. .********* ********.****.

345. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
cgcaccaaggcgatcgcggcgatcccgaccgt	Protospacer
*. ..*  ********** **.*********.

346. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
acgatctcggcgaccgcctcggtcccggtgtc	Protospacer
  *.*********.*** *********..  *

347. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
acgatctcggcgaccgcctcggtcccggtgtc	Protospacer
  *.*********.*** *********..  *

348. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP011771 (Croceicoccus naphthovorans strain PQ-2 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
gatgcgccggcgatcgggtcggtcctgaccag	Protospacer
 * *. .********* ********.****.

349. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 9, identity: 0.719

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
ttggcaacggcgatcgcgtcgatgccgacctt	Protospacer
. **.  **************.* ****** .

350. spacer 5.38|3648564|32|CP029553|CRISPRCasFinder,CRT matches to MN096374 (Microbacterium phage Roman, complete genome) position: , mismatch: 9, identity: 0.719

gcttcgggttctctagcggcgagcacatggtc	CRISPR spacer
gcttcgggtgctctaccggcgagtcgtcgggg	Protospacer
********* ***** *******.   .**

351. spacer 5.38|3648564|32|CP029553|CRISPRCasFinder,CRT matches to MK937596 (Microbacterium phage PhillyPhilly, complete genome) position: , mismatch: 9, identity: 0.719

gcttcgggttctctagcggcgagcacatggtc	CRISPR spacer
gcttcgggtgctctaccggcgagtcgtcgggg	Protospacer
********* ***** *******.   .**

352. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
gtgccgaccccgccgatgatgccgccgcgggc	Protospacer
 . ****** ****************. *

353. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

354. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

355. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015231 (Epibacterium mobile F1926 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
tgcccgaacacgcccatgatgccgccattcag	Protospacer
. .**** ****** ************  * .

356. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

357. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

358. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

359. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032695 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525c, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
gccagcaccatgccgatgatgacgccaagcac	Protospacer
 *.   ****.********** ********

360. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

361. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ggcccgatcaggccgatgatgccgccgggctc	Protospacer
  .****.** ***************..**.

362. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP017244 (Rhizobium etli 8C-3 plasmid pRsp8C3c, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
gcgagcaccatgccgatgatgacgccaagcac	Protospacer
 *    ****.********** ********

363. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

364. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagccc	Protospacer
  .*  .*** ***.****************

365. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ggcccgatcaagccgatgatgccgccgggctc	Protospacer
  .****.** ***************..**.

366. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 9, identity: 0.719

cctccga-----ccacgccgatgatgccgccaagcca	CRISPR spacer
-----aaaagacccgcgccgatgatgccgccgagcga	Protospacer
     .*     **.****************.*** *

367. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
gtgccgactgcgccgatgatgccgccgatgcc	Protospacer
 . *****..****************.*  *

368. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023071 (Sinorhizobium fredii CCBAU 83666 plasmid pSF83666b, complete sequence) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ccgagcaccacgccgatgatgacgccgagaat	Protospacer
**    *************** ****.**

369. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to AP017627 (Pleomorphomonas sp. SM30 plasmid pSM30-1 DNA, complete genome) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ctgccgaccacgccgatcctgccgccgccgcg	Protospacer
*. **************  *******.   *.

370. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to AM040673 (Phage phiSMA9 viral zot gene, rstA gene (partial), and ORF1-5) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgcc---aagcca	CRISPR spacer
atcccgaccacgcccatgacgccgcctttgag---	Protospacer
 ..*********** ****.******   .**

371. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_007189 (Stenotrophomonas phage phiSMA9, complete genome) position: , mismatch: 9, identity: 0.719

cctccgaccacgccgatgatgccgcc---aagcca	CRISPR spacer
atcccgaccacgcccatgacgccgcctttgag---	Protospacer
 ..*********** ****.******   .**

372. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013589 (Rhizobium phaseoli strain N161 plasmid pRphaN161d, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
agtagaagcagcccggcgacgccggagaggaa	Protospacer
 ... *  *** *************** ****

373. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_012586 (Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
atcgcctgcaggccggcgacgccggcccccat	Protospacer
  *** * *****************  *  *

374. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
aacggatccaggccggcgccgccgtactgcgc	Protospacer
 *** ************* ***** * .* .

375. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
aacggatccaggccggcgccgccgtactgcgc	Protospacer
 *** ************* ***** * .* .

376. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
gccgcatcctggccggcgacaccggcccgagc	Protospacer
  ******* **********.****  **..

377. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgcgcacccaggccggcggcgccgggcggccg	Protospacer
*.****.***********.******.  *  .

378. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
tgcgcatccaggcgggcaacgccggcggccag	Protospacer
..*********** ***.******* *   *.

379. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.719

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
cgcgcacccaggccggcggcgccgggcggccg	Protospacer
*.****.***********.******.  *  .

380. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 9, identity: 0.719

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
cacctgccgcgggccgaaggctccgggcgcgg	Protospacer
..*************** **** *** *

381. spacer 5.43|3648869|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 9, identity: 0.719

tgcctgccgcgggccgacggctacggcccgtt	CRISPR spacer
cgtctgccgcgagccggcggctacggtcgtcg	Protospacer
.*.********.****.*********.*  .

382. spacer 5.48|3649174|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP042167 (Burkholderia contaminans strain ZCC plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtgttcttcgcggtgtccacctggatcta	CRISPR spacer
cgcatcagcttcgcggggtcgacctggatctg	Protospacer
  *.*   ******** *** **********.

383. spacer 5.48|3649174|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP046610 (Burkholderia contaminans strain XL73 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gccgtgttcttcgcggtgtccacctggatcta	CRISPR spacer
cgcatcagcttcgcggggtcgacctggatctg	Protospacer
  *.*   ******** *** **********.

384. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NC_031004 (Gordonia phage Nyceirae, complete genome) position: , mismatch: 9, identity: 0.727

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
tcggttcgccgcctcgatcgcttcgaggtgctt	Protospacer
.*****.****** ************ * .

385. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.727

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
gcggttttccgcggcgatcgcttcggtaagccg	Protospacer
 ****** **** ************...*.  *

386. spacer 5.49|3649235|33|CP029553|CRISPRCasFinder,CRT matches to NC_011370 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence) position: , mismatch: 9, identity: 0.727

ccggtttgccgccgcgatcgcttcgacgaaggg	CRISPR spacer
taccatcgtcgccgagatcgcttcgacgaacgg	Protospacer
.    *.*.***** *************** **

387. spacer 5.52|3648991|34|CP029553|PILER-CR matches to MK686071 (Streptomyces phage Mischief19, complete genome) position: , mismatch: 9, identity: 0.735

gcgtggctcggccagacgctcgacatgcttaagg	CRISPR spacer
catctgctcggcgagacgctcgacatgctcgacg	Protospacer
   . ******* ****************..* *

388. spacer 5.52|3648991|34|CP029553|PILER-CR matches to MH825712 (Microbacterium phage ValentiniPuff, complete genome) position: , mismatch: 9, identity: 0.735

gcgtggctcggccagacgctcgacatgcttaagg	CRISPR spacer
tcagagctcggcccgaagctcgacatgctcgaga	Protospacer
 *. .******** ** ************..**.

389. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LR134460 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 18, complete sequence) position: , mismatch: 10, identity: 0.688

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
cgttctctccggcggcgtcggcgcctcgtcgc	Protospacer
* .   ..*****.***.*************

390. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 10, identity: 0.688

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
gtcgaggcccggcaacgccggcgcgtatctct	Protospacer
 ***** *******.********* *  ..

391. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP024310 (Sinorhizobium fredii strain NXT3 plasmid pSfreNXT3c, complete sequence) position: , mismatch: 10, identity: 0.688

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ccatttctccgccagcgcccgcgcctcgtcgc	Protospacer
*.    ..*** ******* ***********

392. spacer 3.10|3236026|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP023064 (Sinorhizobium sp. CCBAU 05631 plasmid pSS05631b, complete sequence) position: , mismatch: 10, identity: 0.688

ctcgagtcccggcagcgccggcgcctcgtcgg	CRISPR spacer
ccatttctccgccagcgcccgcgcctcgtcgc	Protospacer
*.    ..*** ******* ***********

393. spacer 3.12|3236148|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gaggcgatgccgcgggacagcatccggtcccg	CRISPR spacer
tctagcatgccgcgggagagcatccgttccga	Protospacer
   .  *********** ******** *** .

394. spacer 4.1|3388163|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 10, identity: 0.688

accgcaacgcggatcctcgaccggtccgtgat	CRISPR spacer
agtcagttccggatcctggaccggtccgagat	Protospacer
* .  . . ******** ********** ***

395. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 10, identity: 0.688

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
cgtgcgggcgcgaggggcagcatgacgcgcga	Protospacer
. .. *. ******* ********.******

396. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 10, identity: 0.688

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
ggcttgatcgccagacgcagcatggcgctgcc	Protospacer
  *  ****** **.*************   .

397. spacer 4.2|3388224|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP030263 (Ensifer adhaerens strain Corn53 plasmid AA, complete sequence) position: , mismatch: 10, identity: 0.688

tccaggatcgcgaggcgcagcatggcgcgcgt	CRISPR spacer
ggcttgatcgccagacgcagcatggcgctgcc	Protospacer
  *  ****** **.*************   .

398. spacer 4.8|3388590|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP034351 (Streptomyces sp. W1SF4 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

agcttcagataggcccggatctgcgtccgccc	CRISPR spacer
cgctccagataggcccggatccgctcgtacgg	Protospacer
 ***.****************.** . ..*

399. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_MN366357 (Bacterium plasmid pALTS28, complete sequence) position: , mismatch: 10, identity: 0.688

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
tttttgatgggctggcccttgcccgaggactg	Protospacer
    .* .***************** ** **

400. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020047 (Thiomonas intermedia strain ATCC 15466 plasmid pXI1, complete sequence) position: , mismatch: 10, identity: 0.688

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
tttttgatgggctggcccttgcccgaggactg	Protospacer
    .* .***************** ** **

401. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to AJ297913 (Uncultured bacterium plasmid pIPO2T, complete sequence) position: , mismatch: 10, identity: 0.688

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
tttttgatgggctggcccttgcccgaggactg	Protospacer
    .* .***************** ** **

402. spacer 4.11|3388773|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP040765 (Paracoccus sp. 2251 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

gaggcgtcgggctggcccttgcccgcggcctc	CRISPR spacer
ccagcctcgggctggccctttcccgccgaaga	Protospacer
  .** ************** ***** *

403. spacer 4.12|3388163|33|CP029553|PILER-CR matches to NZ_LR134461 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 19, complete sequence) position: , mismatch: 10, identity: 0.697

accgcaacgcggatcctcgaccggtccgtgatg	CRISPR spacer
agtcagttccggatcctggaccggtccgagatg	Protospacer
* .  . . ******** ********** ****

404. spacer 4.15|3388346|33|CP029553|PILER-CR matches to NC_048021 (Gordonia phage Daredevil, complete genome) position: , mismatch: 10, identity: 0.697

cggtcggcgtctcgggtgcggagcacggggcgg	CRISPR spacer
cggccggcgtctcgggtgcggtgccgttgttca	Protospacer
***.***************** **    * . .

405. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

406. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019795 (Thermus thermophilus strain AA2-29 plasmid pAA229, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

407. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

408. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

409. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

410. spacer 5.22|3647577|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP019793 (Thermus thermophilus strain AA2-20 plasmid pAA220, complete sequence) position: , mismatch: 10, identity: 0.688

cgatcccgcgggtagggcgggaaggcggcccc	CRISPR spacer
gaaggagaggggtagggccggaaagcggcccc	Protospacer
 .*    . ********* ****.********

411. spacer 5.29|3648004|32|CP029553|CRISPRCasFinder,CRT matches to KX241618 (Xanthomonas phage Xoo-sp2, complete genome) position: , mismatch: 10, identity: 0.688

tcgctggcctcgggcgcttcgaagtcgaagta	CRISPR spacer
gggtcccgctcgtgcgcctcgaagtcgaagtc	Protospacer
  *..   **** ****.*************

412. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050095 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ttgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

413. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ttgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

414. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NC_008381 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL10, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

415. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020897 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRphaBra5a, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

416. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016500 (Agrobacterium sp. RAC06 plasmid pBSY240_1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtgtcggcactgacgatgctcgggctcgatga	Protospacer
******** *******.******  .*. . .

417. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP053443 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eC, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

418. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP016291 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed6, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ctgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

419. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
ttgccggccctgacgaagctcggcatggacga	Protospacer
 **.************ *******.. . * .

420. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP045856 (Agrobacterium sp. MA01 plasmid punanmed2, complete sequence) position: , mismatch: 10, identity: 0.688

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
gtgtcggcactgacgatgctcgggctcgatga	Protospacer
******** *******.******  .*. . .

421. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to NC_009806 (Kineococcus radiotolerans SRS30216 = ATCC BAA-149 plasmid pKRAD01, complete sequence) position: , mismatch: 10, identity: 0.688

ccctcgtcgaagctgaccgaccggcaagtcgc	CRISPR spacer
gacgtcccgacgctgaccggccggcaagtcct	Protospacer
  * . .*** ********.********** .

422. spacer 5.31|3648126|32|CP029553|CRISPRCasFinder,CRT matches to KT355473 (Arthrobacter phage Jessica, complete genome) position: , mismatch: 10, identity: 0.688

ccctcgtcgaagctgaccgaccggcaagtcgc	CRISPR spacer
aacttgtcgaagctgaccgagcggccgagcta	Protospacer
  **.*************** **** .. *

423. spacer 5.35|3648370|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP020812 (Mycobacterium dioxanotrophicus strain PH-06 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

ctcgcgacgctcacggccttcggggcgacccg	CRISPR spacer
accgcggcgctcagggccttcgggggttgctc	Protospacer
 .****.****** ***********    *.

424. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ttcagcaccacgccgttgatgccgccaggcgc	Protospacer
...   ********* ***********.**

425. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MK510999 (Pseudomonas phage BR58, partial genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ggtccgacctcgccgatgatgctgccgctttt	Protospacer
  ******* ************.***.  ..

426. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MK511000 (Pseudomonas phage CF16, partial genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ggtccgacctcgccgatgatgctgccgctttt	Protospacer
  ******* ************.***.  ..

427. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
ggcccgatcaggccgatgatgccgccgggttc	Protospacer
  .****.** ***************..*..

428. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagctc	Protospacer
  .*  .*** ***.***************.

429. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP049038 (Pseudohalocynthiibacter aestuariivivens strain RR4-35 plasmid pRR4-35_1, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
tgaccgaccgcgccgaagatgccgccgacgac	Protospacer
.  ******.****** *********.*

430. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagctc	Protospacer
  .*  .*** ***.***************.

431. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagctc	Protospacer
  .*  .*** ***.***************.

432. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagctc	Protospacer
  .*  .*** ***.***************.

433. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aaccgcgccaagccaatgatgccgccaagctc	Protospacer
  .*  .*** ***.***************.

434. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022319 (Burkholderia sp. THE68 plasmid BTHE68_p1, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aacaggcccgcgccgatgatgccgccgagcgc	Protospacer
  .  * **.****************.***

435. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
tgaccgaccacgccgctaatgccgccgcagaa	Protospacer
.  ************ *.********. .  *

436. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MH020248 (Mycobacterium phage Panamaxus, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

437. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MN062712 (Mycobacterium phage Pocahontas, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

438. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to KX640831 (Mycobacterium phage Margo, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgcctcgtac	Protospacer
   ********* * ***********  *.

439. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MG812492 (Mycobacterium phage Lambert1, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

440. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MK524496 (Mycobacterium phage Veracruz, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

441. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MH976517 (Mycobacterium phage Popcicle, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

442. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to KT326767 (Mycobacterium phage Texage, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

443. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to KM592966 (Mycobacterium phage QuinnKiro, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

444. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MH316563 (Mycobacterium phage Hookmount, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

445. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to KX670828 (Mycobacterium phage Todacoro, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

446. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to MK494127 (Mycobacterium phage Noella, complete genome) position: , mismatch: 10, identity: 0.688

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aggccgaccacggccatgatgccgccgcgtac	Protospacer
   ********* * ***********. *.

447. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_LN832560 (Paracoccus aminovorans isolate JCM7685 plasmid II, complete sequence) position: , mismatch: 10, identity: 0.688

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
gccaggcccaggccggcgccgccggtgcgggc	Protospacer
  *. ..*********** ****** ****.

448. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 10, identity: 0.688

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
ttgtcctccaggccggcgaggcccgagcgctc	Protospacer
.   * ************* *** *****

449. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 10, identity: 0.688

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
tccctcgccaaggcggcgacgccggagcgggt	Protospacer
. * .  ***.* *****************.

450. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP022567 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK03, complete sequence) position: , mismatch: 10, identity: 0.688

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
tgcagcaccaggccggcgacggcgaagcggtt	Protospacer
..*.   ************** **.*****

451. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP029374 (Acidovorax citrulli strain M6 plasmid pACM6, complete sequence) position: , mismatch: 10, identity: 0.688

cgataggtgtcctggtcctcgatcagcgtgtc	CRISPR spacer
tacctggtctcctggtcttcgatcagcgcgat	Protospacer
.. . *** ********.**********.* .

452. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 10, identity: 0.688

cgataggtgtcctggtcctcgatcagcgtgtc	CRISPR spacer
tcggcggtgacctgggcctcgatcagcggata	Protospacer
. .  **** ***** ************ .*

453. spacer 5.44|3648930|32|CP029553|CRISPRCasFinder,CRT matches to MT723933 (Streptomyces phage Keanu, complete genome) position: , mismatch: 10, identity: 0.688

cgataggtgtcctggtcctcgatcagcgtgtc	CRISPR spacer
agcggcacctcctggtcctcgttcagcatgtc	Protospacer
 *  . .. ************ *****.****

454. spacer 5.45|3648991|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP028970 (Aminobacter sp. MSH1 plasmid pUSP2, complete sequence) position: , mismatch: 10, identity: 0.688

gcgtggctcggccagacgctcgacatgcttaa	CRISPR spacer
gacgggctcgcccagacgcgcgacatggcgcg	Protospacer
*   ****** ******** ******* .  .

455. spacer 5.45|3648991|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.688

gcgtggctcggccagacgctcgacatgcttaa	CRISPR spacer
gcgttgctcggccagatgctcgatggcggcga	Protospacer
**** ***********.******..    ..*

456. spacer 5.45|3648991|32|CP029553|CRISPRCasFinder,CRT matches to NC_012858 (Rhizobium leguminosarum bv. trifolii WSM1325 plasmid pR132502, complete sequence) position: , mismatch: 10, identity: 0.688

gcgtggctcggccagacgctcgacatgcttaa	CRISPR spacer
ctttcgctcgaccagacgctcgacgtgccggt	Protospacer
 . * *****.*************.***. .

457. spacer 5.46|3649052|32|CP029553|CRISPRCasFinder,CRT matches to NC_017273 (Thermus thermophilus SG0.5JP17-16 plasmid pTHTHE1601, complete sequence) position: , mismatch: 10, identity: 0.688

ccgccgcgcacttccagttgatggagttcgcg	CRISPR spacer
tgcccgcggacttccaggtgatggaggacctc	Protospacer
.  ***** ******** ********  * .

458. spacer 5.46|3649052|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 10, identity: 0.688

ccgccgcgcacttccagttgatggagttcgcg	CRISPR spacer
cgtccgcgtacttccagttcatggagcggcaa	Protospacer
*  *****.********** ******.    .

459. spacer 5.46|3649052|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP014142 (Thermus parvatiensis strain RL plasmid pTP143, complete sequence) position: , mismatch: 10, identity: 0.688

ccgccgcgcacttccagttgatggagttcgcg	CRISPR spacer
tgcccgcggacttccaggtgatggaggacctc	Protospacer
.  ***** ******** ********  * .

460. spacer 5.46|3649052|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 10, identity: 0.688

ccgccgcgcacttccagttgatggagttcgcg	CRISPR spacer
cgtccgcgtacttccagttcatggagcggcaa	Protospacer
*  *****.********** ******.    .

461. spacer 5.46|3649052|32|CP029553|CRISPRCasFinder,CRT matches to NC_017590 (Thermus thermophilus JL-18 plasmid pTTJL1802, complete sequence) position: , mismatch: 10, identity: 0.688

ccgccgcgcacttccagttgatggagttcgcg	CRISPR spacer
tgcccgcggacttccaggtgatggaggacctc	Protospacer
.  ***** ******** ********  * .

462. spacer 5.56|3649235|35|CP029553|PILER-CR matches to NC_011370 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG203, complete sequence) position: , mismatch: 10, identity: 0.714

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
taccatcgtcgccgagatcgcttcgacgaacgggg	Protospacer
.    *.*.***** *************** ***

463. spacer 5.56|3649235|35|CP029553|PILER-CR matches to MN892485 (Gordonia phage Kuwabara, complete genome) position: , mismatch: 10, identity: 0.714

ccggtttgccgccgcgatcgcttcgacgaaggggc	CRISPR spacer
tacgggaacagccgcgatcgctacgacgaatgggc	Protospacer
.  *   .* ************ ******* ****

464. spacer 3.13|3236209|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP010863 (Marinovum algicola DG 898 plasmid pMaD8, complete sequence) position: , mismatch: 11, identity: 0.656

aggattcgatgtgccgccgctgtcgatttcga	CRISPR spacer
cctggtctatgtgccgccgctgtggattcacc	Protospacer
   . ** *************** ****.

465. spacer 5.30|3648065|32|CP029553|CRISPRCasFinder,CRT matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 11, identity: 0.656

gtgtcggccctgacgacgctcggcgccacccg	CRISPR spacer
tcgtcggccctgacggcgctgggcggagtgtt	Protospacer
 .*************.**** ****  .. .

466. spacer 5.34|3648309|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

tggccgacctcttcgagcgtgcccgtgccgtc	CRISPR spacer
gccgcgacctcttcgagcgtgacggtgtgcga	Protospacer
    ***************** * ***.

467. spacer 5.36|3648431|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP015989 (Sphingobium sp. EP60837 plasmid pEP2, complete sequence) position: , mismatch: 11, identity: 0.656

caggtctcggcgatcgcgtcggtcccgaccgc	CRISPR spacer
gtcacctcggcgaccgcatcggtcccgaaatg	Protospacer
   ..********.***.**********

468. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 11, identity: 0.656

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aacagacccgcgccgatgatgccgccgagcgc	Protospacer
  .  . **.****************.***

469. spacer 5.41|3648747|32|CP029553|CRISPRCasFinder,CRT matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 11, identity: 0.656

cctccgaccacgccgatgatgccgccaagcca	CRISPR spacer
aacagacccgcgccgatgatgccgccgagcgc	Protospacer
  .  . **.****************.***

470. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP054616 (Azospirillum oryzae strain KACC 14407 plasmid unnamed2, complete sequence) position: , mismatch: 11, identity: 0.656

cacgcatccaggccggcgacgccggagcggaa	CRISPR spacer
tctctcgccaaggcggcgacgccggagcgggt	Protospacer
. . .  ***.* *****************.

471. spacer 5.51|3648930|34|CP029553|PILER-CR matches to MT723933 (Streptomyces phage Keanu, complete genome) position: , mismatch: 11, identity: 0.676

cgataggtgtcctggtcctcgatcagcgtgtcgg	CRISPR spacer
agcggcacctcctggtcctcgttcagcatgtcgt	Protospacer
 *  . .. ************ *****.*****

472. spacer 5.42|3648808|32|CP029553|CRISPRCasFinder,CRT matches to NZ_CP013436 (Burkholderia latens strain AU17928 isolate AU17928 plasmid pAU17928, complete sequence) position: , mismatch: 13, identity: 0.594

cacgcatccaggccggcgacgccggagcggaa-----	CRISPR spacer
----cagcc-gctcggcgacgccggcctgggtgcgtc	Protospacer
    ** ** * .************  .**.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3068467 : 3076979

Acinetobacter_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWN47317.1\|3068467_3069361_+	alpha/beta hydrolase	R4JP33	Mycobacterium_phage	2.0e-10	32.8
AWN47318.1\|3069365_3070214_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	3.9e-56	50.0
AWN47319.1\|3070273_3071287_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	8.9e-55	38.1
AWN47320.1\|3071332_3071968_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	2.3e-53	52.8
AWN47321.1\|3072134_3072617_-	peroxiredoxin	A0A1D7SMT0	Cyanophage	6.8e-21	46.8
AWN50051.1\|3072997_3073543_+	YqgE/AlgH family protein	NA	NA	NA	NA
AWN47322.1\|3073583_3074585_-	hypothetical protein	NA	NA	NA	NA
AWN47323.1\|3075056_3076979_+	molecular chaperone DnaK	A0A0N9QXN8	Chrysochromulina_ericina_virus	6.7e-152	52.9

DBSCAN-SWA_2

3450873 : 3505185

Burkholderia_virus(30.0%)

integrase,protease,transposase,head,portal,capsid,terminase

attL 3493190:3493234|attR 3510808:3510852

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AWN47598.1\|3450873_3451869_+\|protease	serine protease	NA	NA	NA	NA
AWN47599.1\|3451979_3452822_+	flagellar motor protein MotB	NA	NA	NA	NA
AWN47600.1\|3452851_3453799_+	hypothetical protein	NA	NA	NA	NA
AWN47601.1\|3453818_3454772_+	hypothetical protein	NA	NA	NA	NA
AWN47602.1\|3454784_3455072_+	hypothetical protein	NA	NA	NA	NA
AWN50084.1\|3455116_3455380_+	hypothetical protein	NA	NA	NA	NA
AWN50085.1\|3455666_3456938_+	hypothetical protein	NA	NA	NA	NA
AWN47603.1\|3456951_3457530_-	hypothetical protein	NA	NA	NA	NA
AWN47604.1\|3457729_3458779_-	serine endopeptidase	NA	NA	NA	NA
AWN47605.1\|3458784_3459264_-	hypothetical protein	NA	NA	NA	NA
AWN47606.1\|3459287_3459680_+	hypothetical protein	NA	NA	NA	NA
AWN47607.1\|3459935_3461873_-	hypothetical protein	C6ZR20	Salmonella_phage	8.2e-41	28.6
AWN47608.1\|3462423_3463761_+	hypothetical protein	NA	NA	NA	NA
AWN47609.1\|3464203_3464515_-	hypothetical protein	NA	NA	NA	NA
AWN47610.1\|3464759_3465761_-	hypothetical protein	NA	NA	NA	NA
AWN47611.1\|3465762_3466932_-	group 1 glycosyl transferase	NA	NA	NA	NA
AWN47612.1\|3467747_3468134_-	hypothetical protein	NA	NA	NA	NA
AWN47613.1\|3469005_3471774_+	hypothetical protein	NA	NA	NA	NA
AWN47614.1\|3471855_3473577_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	8.7e-18	30.6
AWN47615.1\|3473576_3474890_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
AWN47616.1\|3475328_3475535_+	hypothetical protein	NA	NA	NA	NA
AWN47617.1\|3476324_3476906_+	resolvase	A0A0C4UR34	Shigella_phage	1.2e-43	52.5
AWN47618.1\|3477125_3477605_+	hypothetical protein	NA	NA	NA	NA
AWN47619.1\|3477657_3478116_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
AWN47620.1\|3478968_3480252_+\|transposase	IS66 family transposase	NA	NA	NA	NA
AWN47621.1\|3480565_3481474_-	hypothetical protein	NA	NA	NA	NA
AWN47622.1\|3482498_3485984_-	hypothetical protein	NA	NA	NA	NA
AWN47623.1\|3486194_3486689_-	hypothetical protein	NA	NA	NA	NA
AWN47624.1\|3486690_3487086_-	hypothetical protein	NA	NA	NA	NA
AWN47625.1\|3487740_3488892_-	hypothetical protein	NA	NA	NA	NA
AWN47626.1\|3488888_3489974_-	DUF2169 domain-containing protein	NA	NA	NA	NA
AWN47627.1\|3489984_3492348_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
AWN47628.1\|3492725_3492950_-	hypothetical protein	NA	NA	NA	NA
3493190:3493234	attL	NA	NA	NA	NA
AWN47629.1\|3493296_3494442_-\|integrase	site-specific integrase	Q9ZWV7	Corynephage	1.9e-13	25.5
AWN47630.1\|3495235_3495481_+	hypothetical protein	NA	NA	NA	NA
AWN47631.1\|3495477_3495729_+	hypothetical protein	NA	NA	NA	NA
AWN47632.1\|3496325_3496535_+	hypothetical protein	NA	NA	NA	NA
AWN47633.1\|3497110_3497329_+	hypothetical protein	NA	NA	NA	NA
AWN47634.1\|3497634_3497832_+	hypothetical protein	NA	NA	NA	NA
AWN47635.1\|3497828_3498173_+	hypothetical protein	NA	NA	NA	NA
AWN47636.1\|3498172_3498481_+	HNH endonuclease	Q3HR06	Burkholderia_phage	3.6e-15	45.4
AWN47637.1\|3498616_3498997_+	hypothetical protein	NA	NA	NA	NA
AWN47638.1\|3499009_3500680_+\|terminase	terminase	B5WZR8	Pseudomonas_phage	7.5e-75	37.9
AWN47639.1\|3500667_3501918_+\|portal	phage portal protein	Q6JIM9	Burkholderia_virus	1.1e-73	38.3
AWN47640.1\|3501914_3502616_+\|head,protease	HK97 family phage prohead protease	Q6JIM8	Burkholderia_virus	5.8e-53	57.6
AWN47641.1\|3502626_3503913_+\|capsid	phage major capsid protein	Q6JIM7	Burkholderia_virus	2.6e-83	45.5
AWN47642.1\|3504235_3504856_+	hypothetical protein	NA	NA	NA	NA
AWN47643.1\|3504852_3505185_+	hypothetical protein	A0A286S2A2	Klebsiella_phage	1.2e-05	32.2
3510808:3510852	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP029553

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection