CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP027615	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence	0 crisprs	DEDDh	0	1
CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	1 crisprs	NA	1	0
CP027612	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 chromosome, complete genome	0 crisprs	DEDDh,csa3,cas3,WYL,DinG,RT	0	7
CP027614	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed2, complete sequence	0 crisprs	NA	0	5
CP027616	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed4, complete sequence	0 crisprs	NA	0	2
CP027613	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 108201

117

Salmonella_phage(82.95%)

terminase,tail,integrase,capsid

attL 48538:48558|attR 72588:72608

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98533.1\|1196_2453_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	4.7e-231	90.0
AVO98534.1\|2452_3040_-	DNA-binding protein	J9Q6D4	Salmonella_phage	2.0e-54	57.5
AVO98535.1\|3210_3477_-	hypothetical protein	J9Q757	Salmonella_phage	6.8e-31	74.7
AVO98536.1\|3486_4377_-	hypothetical protein	J9Q7I6	Salmonella_phage	1.1e-138	79.8
AVO98537.1\|4373_4931_-	hypothetical protein	NA	NA	NA	NA
AVO98538.1\|4920_5562_-	ABC transporter	J9Q807	Salmonella_phage	2.0e-97	87.2
AVO98539.1\|5554_6229_-	chromosome partitioning protein ParB	J9Q6L1	Salmonella_phage	1.8e-72	67.3
AVO98540.1\|6212_6926_-	chromosome partitioning protein ParB	J9Q756	Salmonella_phage	2.2e-84	68.3
AVO98541.1\|6991_8569_+	ATP-dependent helicase	J9Q7I4	Salmonella_phage	9.8e-210	71.5
AVO98542.1\|8611_8962_+	hypothetical protein	NA	NA	NA	NA
AVO98543.1\|9025_9574_+	hypothetical protein	NA	NA	NA	NA
AVO98544.1\|9874_10528_+	hypothetical protein	J9Q754	Salmonella_phage	3.5e-52	50.2
AVO98545.1\|11138_11621_-	hypothetical protein	NA	NA	NA	NA
AVO98546.1\|11852_12299_-	hypothetical protein	Q6UAS0	Klebsiella_phage	3.6e-24	44.4
AVO98547.1\|12424_12754_-	hypothetical protein	J9Q7T7	Salmonella_phage	4.5e-16	55.6
AVO98548.1\|12922_13285_-	hypothetical protein	NA	NA	NA	NA
AVO98549.1\|13445_13814_-	hypothetical protein	NA	NA	NA	NA
AVO98645.1\|13813_14026_-	hypothetical protein	J9Q804	Salmonella_phage	1.6e-11	50.0
AVO98550.1\|14046_14265_-	hypothetical protein	J9Q6K7	Salmonella_phage	8.1e-06	35.7
AVO98551.1\|15797_16109_-	hypothetical protein	NA	NA	NA	NA
AVO98552.1\|16299_16620_-	hypothetical protein	J9Q750	Salmonella_phage	4.6e-42	70.8
AVO98553.1\|16690_16918_-	hypothetical protein	NA	NA	NA	NA
AVO98554.1\|16991_17603_-	hypothetical protein	NA	NA	NA	NA
AVO98555.1\|17644_17824_-	hypothetical protein	NA	NA	NA	NA
AVO98556.1\|17832_19497_-	DNA modification methylase	J9Q747	Salmonella_phage	1.6e-210	65.2
AVO98557.1\|19619_20258_-	HD domain-containing protein	J9Q7H7	Salmonella_phage	4.9e-51	53.1
AVO98558.1\|20254_20449_-	hypothetical protein	NA	NA	NA	NA
AVO98559.1\|20445_20706_-	hypothetical protein	I6WB67	Aeromonas_phage	4.8e-05	35.7
AVO98560.1\|20837_21134_+	hypothetical protein	G8C7R5	Escherichia_phage	4.5e-07	39.6
AVO98561.1\|21143_21794_+	hypothetical protein	G8C7R6	Escherichia_phage	5.2e-56	50.5
AVO98562.1\|22406_22724_-	hypothetical protein	NA	NA	NA	NA
AVO98563.1\|22768_23203_-	hypothetical protein	NA	NA	NA	NA
AVO98564.1\|23288_24077_-	hypothetical protein	J9Q7T3	Salmonella_phage	1.3e-82	64.9
AVO98565.1\|24265_24691_-	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	4.1e-54	77.3
AVO98646.1\|25409_25910_-	ribonuclease HI	J9Q745	Salmonella_phage	8.3e-46	54.1
AVO98566.1\|26560_26785_-	hypothetical protein	J9Q7H5	Salmonella_phage	5.4e-13	51.4
AVO98567.1\|26964_27579_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	3.5e-78	71.3
AVO98568.1\|27748_28102_-	hypothetical protein	A0A2H4P7P5	Pseudomonas_phage	1.8e-15	42.9
AVO98569.1\|28101_28920_-	hypothetical protein	J9Q7Z9	Salmonella_phage	4.1e-26	44.1
AVO98570.1\|29056_29599_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	6.2e-55	59.8
AVO98571.1\|29595_30003_-	hypothetical protein	J9Q743	Salmonella_phage	9.2e-11	33.3
AVO98572.1\|30057_30708_-	hypothetical protein	J9Q7H4	Salmonella_phage	5.9e-28	46.2
AVO98573.1\|30704_31187_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	2.8e-43	52.5
AVO98574.1\|31183_31585_-	hypothetical protein	J9Q7Z8	Salmonella_phage	9.7e-13	36.5
AVO98575.1\|31598_32690_-	thymidylate synthase	J9Q6J6	Salmonella_phage	8.2e-131	60.9
AVO98576.1\|32885_33752_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	9.9e-63	47.1
AVO98577.1\|33825_34968_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	2.5e-183	82.4
AVO98578.1\|35087_37415_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	71.6
AVO98579.1\|37495_38068_-	hypothetical protein	J9Q7Z7	Salmonella_phage	4.8e-58	58.1
AVO98580.1\|38084_38783_-	hypothetical protein	NA	NA	NA	NA
AVO98581.1\|38772_40689_-	exonuclease	J9Q741	Salmonella_phage	1.6e-185	55.3
AVO98582.1\|40685_41771_-	exonuclease	J9Q7S9	Salmonella_phage	1.5e-148	72.0
AVO98583.1\|42006_42654_-	hypothetical protein	J9Q739	Salmonella_phage	1.8e-61	51.6
AVO98584.1\|42970_44083_+	replication initiation protein	J9Q7H0	Salmonella_phage	4.1e-77	47.5
AVO98585.1\|44447_44663_-	hypothetical protein	J9Q7S8	Salmonella_phage	8.8e-05	42.9
AVO98586.1\|44662_45001_-	hypothetical protein	NA	NA	NA	NA
AVO98647.1\|45190_45397_-	hypothetical protein	J9Q738	Salmonella_phage	2.0e-14	52.2
AVO98587.1\|45564_45762_-	hypothetical protein	NA	NA	NA	NA
AVO98588.1\|45952_46264_-	hypothetical protein	A0A2H4FWM4	Salmonella_phage	1.0e-09	69.8
AVO98589.1\|46253_46994_-	hypothetical protein	G4KK93	Yersinia_phage	1.4e-25	32.7
AVO98590.1\|47129_47387_-	hypothetical protein	NA	NA	NA	NA
AVO98591.1\|47476_48304_-	SPFH/Band 7/PHB domain protein	G0YQD7	Erwinia_phage	1.9e-103	67.9
AVO98592.1\|48300_48570_-	hypothetical protein	NA	NA	NA	NA
48538:48558	attL	NA	NA	NA	NA
AVO98593.1\|48626_49352_+	hypothetical protein	NA	NA	NA	NA
AVO98648.1\|49369_50410_-	recombinase	J9Q736	Salmonella_phage	5.4e-148	72.6
AVO98594.1\|50453_50714_-	hypothetical protein	NA	NA	NA	NA
AVO98595.1\|50710_51688_-	exonuclease	J9Q7S6	Salmonella_phage	1.4e-121	65.4
AVO98596.1\|51733_52711_-	regulator	J9Q7Z3	Salmonella_phage	3.6e-61	45.6
AVO98597.1\|52777_53218_-	hypothetical protein	J9Q6I8	Salmonella_phage	3.5e-32	48.3
AVO98598.1\|53427_53850_-	hypothetical protein	NA	NA	NA	NA
AVO98599.1\|53846_55007_-	uracil-DNA glycosylase	J9Q7Z2	Salmonella_phage	3.0e-139	62.6
AVO98600.1\|55077_57450_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	8.7e-311	66.7
AVO98601.1\|57446_57635_-	hypothetical protein	J9Q6I7	Salmonella_phage	2.3e-09	48.2
AVO98602.1\|57627_58878_-	porphyrin biosynthesis protein	J9Q733	Salmonella_phage	1.5e-144	62.6
AVO98603.1\|58976_60989_-	hypothetical protein	J9Q7G6	Salmonella_phage	3.3e-125	45.7
AVO98604.1\|61075_61294_-	hypothetical protein	NA	NA	NA	NA
AVO98605.1\|61599_61905_+	XRE family transcriptional regulator	NA	NA	NA	NA
AVO98649.1\|61894_62941_-\|integrase	integrase	A0A1P8DTG6	Proteus_phage	2.1e-19	28.4
AVO98606.1\|63112_63697_+	hypothetical protein	NA	NA	NA	NA
AVO98607.1\|64001_64325_-	hypothetical protein	A0A2H4IBK3	Erwinia_phage	8.3e-23	48.6
AVO98608.1\|64414_64660_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.9e-11	44.6
AVO98609.1\|64885_65131_-	hypothetical protein	A0A1S6UB66	Serratia_phage	7.9e-18	58.0
AVO98650.1\|65127_65568_-	DUF2829 domain-containing protein	K4N0H8	Escherichia_phage	3.9e-23	43.8
AVO98610.1\|65659_66490_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	2.0e-89	64.8
AVO98611.1\|66656_67268_-	hypothetical protein	S4TP42	Salmonella_phage	1.7e-16	33.7
AVO98612.1\|68509_68761_-	hypothetical protein	NA	NA	NA	NA
AVO98613.1\|68912_69128_-	hypothetical protein	J9Q6I3	Salmonella_phage	3.1e-18	62.9
AVO98614.1\|69111_69312_-	hypothetical protein	NA	NA	NA	NA
AVO98615.1\|69308_70637_-	DNA ligase	J9Q7G5	Salmonella_phage	1.5e-182	70.6
AVO98616.1\|70636_71107_-	hypothetical protein	NA	NA	NA	NA
AVO98617.1\|71643_72555_-	hypothetical protein	NA	NA	NA	NA
AVO98618.1\|72617_73733_-	DNA primase	J9Q720	Salmonella_phage	2.0e-148	66.6
72588:72608	attR	NA	NA	NA	NA
AVO98619.1\|73867_75229_-	DNA helicase	J9Q7G4	Salmonella_phage	4.5e-179	70.1
AVO98620.1\|75273_76014_-	hypothetical protein	J9Q7R8	Salmonella_phage	3.1e-73	53.0
AVO98621.1\|76342_76714_-	hypothetical protein	J9Q7G3	Salmonella_phage	6.4e-19	52.6
AVO98622.1\|76715_77384_-	plasmid stability protein	J9Q7R7	Salmonella_phage	1.8e-88	70.5
AVO98623.1\|77701_77953_-	hypothetical protein	J9Q7R6	Salmonella_phage	1.3e-12	47.0
AVO98624.1\|77949_78642_-	hypothetical protein	J9Q7Y7	Salmonella_phage	1.1e-99	78.0
AVO98625.1\|78652_78967_-	hypothetical protein	J9Q6E7	Salmonella_phage	2.3e-33	69.8
AVO98626.1\|79048_80590_-	endosialidase chaperone	A0A0H4TGH1	Klebsiella_phage	6.1e-47	43.1
AVO98627.1\|80636_94121_-	hypothetical protein	J9Q713	Salmonella_phage	1.2e-37	55.2
AVO98628.1\|94132_94744_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	6.5e-69	62.6
AVO98629.1\|94731_95535_-\|tail	phage tail protein	J9Q7R4	Salmonella_phage	2.2e-117	76.4
AVO98630.1\|95524_96223_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	2.3e-102	76.1
AVO98631.1\|96279_96615_-\|tail	phage tail protein	J9Q6E1	Salmonella_phage	2.7e-45	73.6
AVO98632.1\|96663_101220_-	hypothetical protein	J9Q712	Salmonella_phage	2.3e-174	36.1
AVO98633.1\|101224_101452_-	hypothetical protein	J9Q7F7	Salmonella_phage	2.0e-23	75.3
AVO98634.1\|101580_101898_-	hypothetical protein	J9Q7R3	Salmonella_phage	3.1e-30	64.8
AVO98635.1\|102847_103297_-	hypothetical protein	NA	NA	NA	NA
AVO98636.1\|103386_103767_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-30	46.8
AVO98637.1\|103766_104261_-	hypothetical protein	J9Q711	Salmonella_phage	7.2e-34	51.2
AVO98638.1\|104251_104596_-	hypothetical protein	J9Q7F6	Salmonella_phage	1.1e-33	57.9
AVO98639.1\|104606_105440_-	hypothetical protein	J9Q7R2	Salmonella_phage	9.2e-74	49.3
AVO98640.1\|105439_105865_-	hypothetical protein	J9Q7Y3	Salmonella_phage	9.5e-43	64.3
AVO98641.1\|105906_106341_-	hypothetical protein	J9Q6D6	Salmonella_phage	4.7e-21	43.4
AVO98642.1\|106414_107287_-\|capsid	phage major capsid protein	J9Q710	Salmonella_phage	1.0e-131	81.4
AVO98643.1\|107316_108201_-	hypothetical protein	J9Q7F4	Salmonella_phage	1.7e-81	59.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP027617

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP027617_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP027617_1

51738-51859

Orphan

Consensus_repeat	Method
TATCTTGGTTTAGGGGGGGGGATTTATCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP027617_1

>merge|CP027617|1|51738-51859|CRISPRCasFinder
TTACAGGTTTAGGGGGGGGTAATTTATCTTGGTTTAGGGGGGGGGATTTATCTCGGTTAGGGGGGCAATTTATCTTGCTAGGGGGGGGTAATATATCTCGGTTTAGGGGGGGGGATTTATCT

>CP027617|1|1|51738-51859|CRISPRCasFinder
TTACAGGTTTAGGGGGGGGTAATTTATCT	TGGTTTAGGGGGGGGGATTTATCTCGGTTAGGGGGGCAATTTATCTTGCTAGGGGGGGGTAATA
TATCTCGGTTTAGGGGGGGGGATTTATCT

Protein	Signature genes	Signature genes Name	Protein_function
CP027617.1\|AVO98858.1\|48641_48833_-\|hypothetical-protein	unknown	unknown	unknown
CP027617.1\|AVO98840.1\|47377_47662_-\|hypothetical-protein	unknown	unknown	unknown
CP027617.1\|AVO98843.1\|48949_49372_-\|ArdB-protein	unknown	unknown	gnl\|CDD\|377006
CP027617.1\|AVO98841.1\|47710_48091_-\|hypothetical-protein	unknown	unknown	unknown
CP027617.1\|AVO98839.1\|45946_46420_-\|MFS-sugar-transporter	unknown	unknown	gnl\|CDD\|236610
CP027617.1\|AVO98848.1\|52944_53277_+\|hypothetical-protein	unknown	unknown	unknown
CP027617.1\|AVO98842.1\|48074_48638_-\|antirestriction-protein-ArdR	unknown	unknown	unknown
CP027617.1\|AVO98838.1\|44441_45935_-\|alpha-N-arabinofuranosidase	unknown	unknown	gnl\|CDD\|226064
CP027617.1\|AVO98845.1\|50369_50903_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236362
CP027617.1\|AVO98844.1\|49551_50340_+\|sprT-domain-containing-protein	unknown	unknown	gnl\|CDD\|370932
CP027617.1\|AVO98850.1\|54047_54233_-\|ribbon-helix-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|289422
CP027617.1\|AVO98847.1\|51923_52805_-\|replication-protein	unknown	unknown	gnl\|CDD\|309782
CP027617.1\|AVO98849.1\|53442_54051_+\|resolvase	unknown	unknown	gnl\|CDD\|239736
CP027617.1\|AVO98846.1\|51019_51349_-\|ArdK-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|374591

Protein	Function_ID	Function_description	E-value
CP027617.1\|AVO98849.1\|53442_54051_+\|resolvase	gnl\|CDD\|239736	cd03767, SR_Res_par, Serine recombinase (SR) family, Partitioning (par)-Resolvase subfamily, catalytic domain; Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subgroup is composed of proteins similar to the E. coli resolvase found in the par region of the RP4 plasmid, which encodes a highly efficient partitioning system. This protein is part of a complex stabilization system involved in the resolution of plasmid dimers during cell division. Similar to Tn3 and other resolvases, members of this family may contain a C-terminal DNA binding domain.	4.55012e-61
CP027617.1\|AVO98838.1\|44441_45935_-\|alpha-N-arabinofuranosidase	gnl\|CDD\|226064	COG3534, AbfA, Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].	0
CP027617.1\|AVO98843.1\|48949_49372_-\|ArdB-protein	gnl\|CDD\|377006	pfam03230, Antirestrict, Antirestriction protein. This family includes various protein that are involved in antirestriction. The ArdB protein efficiently inhibits restriction by members of the three known families of type I systems of E. coli.	2.16047e-18
CP027617.1\|AVO98845.1\|50369_50903_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|236362	PRK09010, PRK09010, single-stranded DNA-binding protein; Provisional.	1.58918e-85
CP027617.1\|AVO98839.1\|45946_46420_-\|MFS-sugar-transporter	gnl\|CDD\|236610	PRK09669, PRK09669, putative symporter YagG; Provisional.	9.51947e-27
CP027617.1\|AVO98847.1\|51923_52805_-\|replication-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	1.86101e-26
CP027617.1\|AVO98844.1\|49551_50340_+\|sprT-domain-containing-protein	gnl\|CDD\|370932	pfam10263, SprT-like, SprT-like family. This family represents a domain found in eukaryotes and prokaryotes. The domain contains a characteristic motif of the zinc metallopeptidases. This family includes the bacterial SprT protein.	5.57072e-11
CP027617.1\|AVO98846.1\|51019_51349_-\|ArdK-family-transcriptional-regulator	gnl\|CDD\|374591	pfam16509, KORA, TrfB plasmid transcriptional repressor. KORA is a family of Gram-negative bacterial proteins that act as global repressors of genes involved in plasmid replication, conjugative transfer and stable inheritance in the IncP group of plasmids. KORA operates as a symmetric dimer, and contacts the DNA via the helix-turn-helix region at the N-terminus.	2.69416e-20
CP027617.1\|AVO98850.1\|54047_54233_-\|ribbon-helix-helix-domain-containing-protein	gnl\|CDD\|289422	pfam12651, RHH_3, Ribbon-helix-helix domain. This short bacterial protein contains a ribbon-helix-helix domain that is likely to be DNA-binding.	2.78035e-11

>CP027617.1|AVO98846.1|51019_51349_-|ArdK-family-transcriptional-regulator
MARKQTRSMTQEEWDRLLPAMQTFTHLSTEIGHSVLVKGESNKDVAERVGRTKQNVGSTVKRIWDLYQSVAVDFEGEKLRKVDVWLPEKMALKVLKEAEKYAINQNKTE
>CP027617.1|AVO98845.1|50369_50903_-|single-stranded-DNA-binding-protein
MASRGVNKVILVGNLGQDPEMRYMPNGGAVANLRLATSESWRDKATGEQKEVTEWHTVVIFGKLAEIAGEYLRKGSQVYIEGQLRTRKWQDKDQQDRYSTEVVVSMNGVMQMLGGRQGGGAPAGQGGQQQFSGGGAPAAAPGTQGQQPQQGAMPDFEDDIPFAPVTLPFPNHAIHAL
>CP027617.1|AVO98844.1|49551_50340_+|sprT-domain-containing-protein
MTLPTPETYEELQHAYDFFDERLFNNELPPCLITLQREKRTYGYCSFQRFVGRESGQMVDEIAMNPVFFSIRTIKATLSSLVHEMVHQWQYHFGKAGRRGYHNKEWSAMMERIGLMPSDTGQPGGRKVGQSMAHYIITGGAFDRACDELLTRNFQLSWMDRFPPFQPKPGAPQSPSGKGYIDDENDDREYPPDDDYTDEPGELDNEIIEAMKFVSPPPETPVNKSNRAKYTCPVCHVNLWGKPGLVVFCGGEHCEKAELQPS
>CP027617.1|AVO98843.1|48949_49372_-|ArdB-protein
MANTVTAKIYGPAQKMRFLPYAFAEFYLQAENYVCSFMKKYAVGYDGGCWEYITYENGACAFIAPDGYQLTLPNYFDEPVSAKEAGIIVALYAYSHFCCVAFERGWQRVNETMAERYHTLRDFTETLPPESQSRIFRAID
>CP027617.1|AVO98858.1|48641_48833_-|hypothetical-protein
MASVRFWPDIQETIFPPLQVPEGKRRVVRCRCGINDWNEDGRWLGEYCCASCGQYIQVFEKKD
>CP027617.1|AVO98842.1|48074_48638_-|antirestriction-protein-ArdR
MAFDFKKEDAAKYGREVYRAFRSKGNHRWDTCVFVNESGAYSAVFRHSFRKKVIEDGKEIRRNVIDDEIVVAAPDAGSFTRAKFPQLADAKELKQSGFFARLRFVAEASAYREAWPGHDGGVVLIWEGKAYGWKNCLRDAHHERPGAIAIDTNGHVFIAEGGNEYDGAKCWVAMTGDITEGDNGDKS
>CP027617.1|AVO98841.1|47710_48091_-|hypothetical-protein
MVIKVNGVALLAILFISATAMAGIKSPIKVVSLIDFRGDNQELMVRDTESQCDYHVAVTKSEKNIEWLGVTLPQSRWEFVVDRRKCGDIIERVNMQIVPDTKIKTLPIEAGSVYYIYPDWDAFSQK
>CP027617.1|AVO98840.1|47377_47662_-|hypothetical-protein
MEQPTDMFSMYLKFIPVILAVIFWIYCLSSKYSLSRMETMRQLKRWYDLPRASATENKEETLNNMIAAEQKRAALSFRTAIVFTAIAIFWLVYI
>CP027617.1|AVO98839.1|45946_46420_-|MFS-sugar-transporter
MKLYIYVGFITAAISILIYFIDPRNIETIFALNTLRGYIGAITVPIFWSFIGDADDFGAWKFKRRMSGVYASGNLFALKVSLAIAGTITATILSLTHYVPDAPQQTPETLNAIMLLITVIPAAGSIITSLLFLFFYKLDTRMMNEIQTDLKANHYPA
>CP027617.1|AVO98838.1|44441_45935_-|alpha-N-arabinofuranosidase
MSKLHFAITPDNRIAEINPRLFGSFVEHLGRAVYTGIYEPGHPEADAQGFRQDVINLVKEMNVTTVRYPGGNYVSGFNWRDGIGPKEERPVRLDYAWISKESNQFGISEFNHWCQQTHVEPMIAINLGTGTPQEAGYFIEYCNHPGGTTLSDLRVQHGDAEPYNFKLWCLGNEMDGPWQTGQMSADDYAKKARETAKILRCVDPEVELIACGSSSSMMDTFPTWDRVVLEELYDYVDYISCHQYYENEGTESDFLASFVNMDNFIETIVSTANYVKAYKRGKKDIMISFDEWNVWYLRGDPWDAPMKHKENRFKVAPPLLEDRYSFLDALVVGGLLCSLINHCDRVKMASLAQLVNVIAPIFTEAGGGVIRQTIFWPFAMVANVAKGSALRHFIPAGTFSSKYGDARRIQSAVVHNAAAGKLYLFALNSDFHDSFTLDPDLSAFGQTRLAEHQILRCDDLYAKNTFDRPDRVAPETLTASDLTLPPLSWNRITFDIL
>CP027617.1|AVO98847.1|51923_52805_-|replication-protein
MAEDRKQLTKRQQKAIDTAALIRQEPPQGDDMAFTHSILCQVGLPRSKVEGREFMRRSGDAWLVVQAGWLDEGNGPVEQPLPYGAMPRLTFAWISSYALRNKTREIAIGHSASEFLRLMGMELQGARHRTLRIQMQALAACRLQLGFKGRTYNGQPVEQFDAWLKDGDTKQLTLWPGTLTLSEGYYNGLIESAVPLDNRALHVLKGSALALDIYAWLAHRLHRIEGRPVMLYWMKLREQFAQEYSGKNADKDFKRAFMPALKQVLSVYPAAKVDQVKGGLLLYSSPPPIPYKS
>CP027617.1|AVO98848.1|52944_53277_+|hypothetical-protein
MTERQQNRNICVVGKVKDGMTIDTSKIKIEDVSERVISIDDSFNTEDATLSLRTVMRNVATRIYLPSVLKGACPAFEAWADKRSVGEKLPRGKYFKSREFIRQFKIQNYV
>CP027617.1|AVO98849.1|53442_54051_+|resolvase
MYIFGYLRASAHDQDASRAQQRLKAFALEHNHRVAGWYVENASGASLQRPELMRLLNDAEKGDLILIEQVDRLSRLDDEGWQQLKRMMQEKNLAIISLDLPTSYAALMPHGSDEFTRSMLTAINSMMLDMLAAIARKDYTDRRRRQQEGVRKAKEKGVYRGRMPDQNKHDLIRSLRHQGKSISETARLAGVSERTVTRVSKS
>CP027617.1|AVO98850.1|54047_54233_-|ribbon-helix-helix-domain-containing-protein
MAEPYLKNRRRFTSSLDNQLVPLFDALAAKTRIPKSRLLDEAIEDLLVKHGVPGKQVDSQN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP026279	Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence	23224-23287	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_KT148595	Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence	976-1039	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP026274	Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence	169583-169646	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP027617	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence	51767-51830	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP029112	Escherichia coli strain AR436 plasmid unnamed3, complete sequence	16875-16938	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP026184	Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence	14094-14157	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP011646	Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence	74601-74664	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP027125	Escherichia coli strain AR_0374 plasmid unnamed3	38511-38574	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP010382	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence	22397-22460	4	0.938
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP026205	Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence	22855-22918	5	0.922
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP026232	Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence	7925-7988	6	0.906
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP017587	Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence	38069-38132	7	0.891
CP027617_1	1.1\|51767\|64\|CP027617\|CRISPRCasFinder	51767-51830	64	NZ_CP019907	Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence	8399-8462	9	0.859

1. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP026279 (Klebsiella oxytoca strain KONIH2 plasmid pKOR-b08d, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

2. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_KT148595 (Klebsiella pneumoniae subsp. pneumoniae strain GN1006 plasmid pKPC-SMH, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

3. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP026274 (Klebsiella oxytoca strain KONIH4 plasmid pKPC-4b66, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

4. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP027617 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

5. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP029112 (Escherichia coli strain AR436 plasmid unnamed3, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

6. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP026184 (Klebsiella pneumoniae strain KPNIH49 plasmid pKPN-af73, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

7. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP011646 (Klebsiella pneumoniae strain CAV1596 plasmid pKPC_CAV1596-97, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

8. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP027125 (Escherichia coli strain AR_0374 plasmid unnamed3) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

9. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP010382 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-53.129kb, complete sequence) position: , mismatch: 4, identity: 0.938

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	Protospacer
************************************************************

10. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP026205 (Escherichia coli strain ECONIH5 plasmid pKPC-e3ee, complete sequence) position: , mismatch: 5, identity: 0.922

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatttatctcggttaggggggcaatttatcttgcta-gggggggt	Protospacer
*************************************************** ********

11. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP026232 (Citrobacter freundii complex sp. CFNIH4 plasmid pKPC-c9fd, complete sequence) position: , mismatch: 6, identity: 0.906

-tggtttagggggggggatttatctcggttaggggggcaatttatcttgctagggggggg	CRISPR spacer
ttggttta-ggggggggatttatctcggttaggggggcaatttatcttgctagggggggg	Protospacer
 ******* ***************************************************

12. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP017587 (Pantoea stewartii subsp. stewartii DC283 plasmid pDSJ06, complete sequence) position: , mismatch: 7, identity: 0.891

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
tggtttagggggggggatatatctcggttaggggggcaatttatcttgctagggggggta	Protospacer
****************** ***************************************

13. spacer 1.1|51767|64|CP027617|CRISPRCasFinder matches to NZ_CP019907 (Escherichia coli strain MDR_56 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.859

tggtttagggggggggatttatctcggttaggggggcaatttatcttgctaggggggggt	CRISPR spacer
cggtttagggggggtgatatatctcggttaggggggcaatttatcttgctagggggggta	Protospacer
.************* *** ***************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP027613

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7070 : 96428

105

Klebsiella_phage(35.71%)

portal,head,tail,protease,integrase,transposase,terminase,holin,capsid

attL 55759:55818|attR 94215:96480

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98198.1\|7070_7994_+\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	4.1e-176	98.7
AVO98199.1\|8611_8992_+	copper resistance system chaperone PcoC	NA	NA	NA	NA
AVO98200.1\|8996_9926_+	copper resistance protein D	NA	NA	NA	NA
AVO98201.1\|9980_10661_+	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4
AVO98202.1\|10657_12058_+	sensor histidine kinase	W8CYF6	Bacillus_phage	2.4e-18	26.6
AVO98203.1\|12273_12708_+	copper-binding protein	NA	NA	NA	NA
AVO98204.1\|12840_14430_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	8.1e-188	65.7
AVO98205.1\|14459_14810_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZBY2	Stx2-converting_phage	3.1e-39	64.7
AVO98206.1\|14806_15214_-	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.4e-14	40.2
AVO98207.1\|15587_15707_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
AVO98208.1\|15672_15852_-	antitoxin	NA	NA	NA	NA
AVO98209.1\|16164_16410_+	hypothetical protein	NA	NA	NA	NA
AVO98210.1\|16414_16987_+	hypothetical protein	NA	NA	NA	NA
AVO98211.1\|17017_17512_+	DNA-binding protein	NA	NA	NA	NA
AVO98212.1\|17572_17776_+	hemolysin expression modulator Hha	NA	NA	NA	NA
AVO98213.1\|17789_18020_+	hypothetical protein	NA	NA	NA	NA
AVO98214.1\|18152_19381_-\|transposase	IS3 family transposase	Q9ZXG3	Shigella_phage	3.5e-170	95.7
AVO98397.1\|19472_19727_+	hypothetical protein	NA	NA	NA	NA
AVO98215.1\|19929_21333_+\|transposase	ISNCY family transposase ISKpn21	NA	NA	NA	NA
AVO98216.1\|21361_21994_-	hypothetical protein	NA	NA	NA	NA
AVO98398.1\|22219_23566_+\|transposase	transposase	NA	NA	NA	NA
AVO98217.1\|23614_24019_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AVO98218.1\|24408_25113_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AVO98219.1\|25216_25573_-	cupin domain-containing protein	NA	NA	NA	NA
AVO98220.1\|25562_25964_-	DUF86 domain-containing protein	NA	NA	NA	NA
AVO98221.1\|25960_26251_-	nucleotidyltransferase	NA	NA	NA	NA
AVO98222.1\|27389_28394_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AVO98223.1\|29829_30045_-	hypothetical protein	NA	NA	NA	NA
AVO98224.1\|30267_31350_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.4e-185	96.1
AVO98225.1\|31471_34546_+	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	96.7
AVO98226.1\|34597_35851_+	MFS transporter	NA	NA	NA	NA
AVO98227.1\|35907_36078_+	galactoside O-acetyltransferase	NA	NA	NA	NA
AVO98228.1\|36956_37217_-	DUF2534 domain-containing protein	NA	NA	NA	NA
AVO98229.1\|37273_39337_-	TonB-dependent copper receptor	NA	NA	NA	NA
AVO98230.1\|39419_39839_-	DUF2946 domain-containing protein	NA	NA	NA	NA
AVO98231.1\|40199_41204_+\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AVO98232.1\|41385_41658_-	hypothetical protein	NA	NA	NA	NA
AVO98233.1\|41676_41856_+	hypothetical protein	NA	NA	NA	NA
AVO98234.1\|41785_42625_-	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
AVO98235.1\|42618_42966_-	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
AVO98236.1\|43129_43921_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
AVO98237.1\|44328_44826_-	trimethoprim-resistant dihydrofolate reductase DfrA12	A0A0A0PL85	Bacillus_phage	7.5e-23	40.9
AVO98238.1\|44970_45984_+\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AVO98239.1\|45922_46537_+	DUF3330 domain-containing protein	NA	NA	NA	NA
AVO98240.1\|46993_47698_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.2e-138	99.6
AVO98241.1\|48670_49759_-	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AVO98242.1\|49845_50106_-	hypothetical protein	A0A077SK33	Escherichia_phage	1.9e-41	100.0
AVO98243.1\|50403_51264_+	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
AVO98244.1\|51284_52046_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AVO98245.1\|52306_53209_+	oxidoreductase	A0A077SLF7	Escherichia_phage	1.3e-158	99.7
AVO98246.1\|53220_54486_+	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	2.7e-234	100.0
AVO98247.1\|54478_55099_+	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
55759:55818	attL	NA	NA	NA	NA
AVO98248.1\|55810_56515_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVO98249.1\|57267_57972_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVO98250.1\|60790_61171_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	4.6e-73	100.0
AVO98251.1\|61180_61663_-	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	3.2e-79	91.2
AVO98252.1\|61659_62130_-	hypothetical protein	A0A286S298	Klebsiella_phage	8.3e-64	67.7
AVO98253.1\|62129_64562_-\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	0.0e+00	93.1
AVO98254.1\|64625_65057_-	hypothetical protein	A0A286S1N7	Klebsiella_phage	9.6e-67	99.2
AVO98255.1\|65053_65317_-\|tail	phage tail protein	A0A286S1P2	Klebsiella_phage	6.9e-44	98.9
AVO98256.1\|65349_65703_-\|tail	phage tail protein	A0A286S1N4	Klebsiella_phage	4.9e-61	99.1
AVO98257.1\|65746_66238_-\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	2.3e-88	100.0
AVO98258.1\|66294_66660_-	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.9e-61	92.6
AVO98259.1\|66656_67196_-	hypothetical protein	A0A286S249	Klebsiella_phage	1.0e-94	100.0
AVO98260.1\|67188_67521_-\|head,tail	head-tail adaptor protein	A0A286S2A2	Klebsiella_phage	3.1e-57	100.0
AVO98261.1\|67522_67720_-	hypothetical protein	A0A286S2A5	Klebsiella_phage	1.7e-26	100.0
AVO98262.1\|67780_68107_-\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	7.5e-56	100.0
AVO98263.1\|68333_69497_-\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	3.8e-211	99.5
AVO98264.1\|69508_70189_-\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.6e-124	100.0
AVO98265.1\|70194_71472_-\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	6.2e-247	100.0
AVO98266.1\|71474_73007_-\|terminase	terminase	A0A286S1M9	Klebsiella_phage	1.1e-295	99.8
AVO98267.1\|73016_73451_-	hypothetical protein	A0A286S1P9	Klebsiella_phage	6.2e-74	100.0
AVO98268.1\|73572_73782_-	serine acetyltransferase	A0A286N2R4	Klebsiella_phage	1.2e-25	88.4
AVO98269.1\|73794_74085_-	HNH endonuclease	A0A286N2R3	Klebsiella_phage	2.6e-52	96.9
AVO98270.1\|74156_74363_-	DUF551 domain-containing protein	A0A286N2R2	Klebsiella_phage	2.7e-35	100.0
AVO98271.1\|74434_74680_-	DUF2560 domain-containing protein	A0A286N2R1	Klebsiella_phage	1.6e-34	98.8
AVO98272.1\|75493_75688_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.1e-25	90.6
AVO98273.1\|75638_75914_-	hypothetical protein	G8C7W1	Escherichia_phage	6.0e-06	37.1
AVO98274.1\|75916_76546_-	endolysin	F1C591	Cronobacter_phage	7.1e-87	74.4
AVO98275.1\|76545_76827_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	4.8e-19	48.4
AVO98276.1\|76813_77200_-	hypothetical protein	A0A192Y8P2	Salmonella_phage	1.6e-57	90.6
AVO98277.1\|77409_77814_-	antitermination protein	S5M7R9	Escherichia_phage	9.4e-32	53.2
AVO98278.1\|77803_78448_-	DNA methyltransferase	I6PDF5	Cronobacter_phage	5.2e-85	68.7
AVO98279.1\|78444_78687_-	hypothetical protein	A0A1V0E5R3	Salmonella_phage	9.2e-27	68.8
AVO98280.1\|78683_79328_-	NinG family protein	A0A1W6JNX3	Morganella_phage	1.5e-39	54.3
AVO98281.1\|79297_80269_-	DNA primase	A0A286N2Q0	Klebsiella_phage	7.8e-109	60.7
AVO98282.1\|80265_81795_-	ATP-dependent helicase	A0A286N2P9	Klebsiella_phage	6.6e-203	66.9
AVO98283.1\|81787_82063_-	hypothetical protein	NA	NA	NA	NA
AVO98284.1\|82225_82504_-	hypothetical protein	A0A1B5FPB9	Escherichia_phage	2.1e-14	47.1
AVO98285.1\|82542_83058_-	DNA-binding protein	A0A1C9II13	Salmonella_phage	1.5e-58	63.4
AVO98286.1\|83101_83302_-	transcriptional regulator	U5P445	Shigella_phage	2.8e-21	76.9
AVO98399.1\|83392_84067_+	LexA family transcriptional repressor	U5P0T5	Shigella_phage	3.3e-114	86.8
AVO98287.1\|84669_85152_-	superinfection exclusion protein B	A4KWR7	Enterobacteria_phage	6.3e-51	60.6
AVO98288.1\|85623_85983_+	hypothetical protein	A0A1P8D5Q7	Corynebacterium_phage	1.3e-05	30.4
AVO98289.1\|86026_86839_+	DUF2303 domain-containing protein	I6NVL7	Burkholderia_virus	4.4e-28	30.5
AVO98290.1\|86920_87781_+	DNA-binding protein	A0A2H4J902	uncultured_Caudovirales_phage	1.0e-72	58.7
AVO98291.1\|87970_88099_+\|integrase	integrase	NA	NA	NA	NA
AVO98292.1\|88095_88320_+	hypothetical protein	S4TVX5	Salmonella_phage	1.3e-14	53.8
AVO98293.1\|88312_88567_+	hypothetical protein	NA	NA	NA	NA
AVO98400.1\|88813_89404_+	DUF550 domain-containing protein	S4TSR6	Salmonella_phage	4.7e-32	55.7
AVO98294.1\|89405_89969_+	3'-5' exoribonuclease	A0A192Y6E0	Salmonella_phage	1.5e-67	64.1
AVO98295.1\|89976_90240_+	pyocin activator protein PrtN	K7PGU0	Enterobacteria_phage	4.2e-17	51.8
AVO98296.1\|91040_93830_-	hypothetical protein	NA	NA	NA	NA
AVO98297.1\|94266_94971_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AVO98298.1\|95723_96428_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
94215:96480	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP027614

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6163

Salmonella_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98410.1\|2127_2688_-\|transposase	transposase	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
AVO98411.1\|2863_3853_-	DUF3330 domain-containing protein	NA	NA	NA	NA
AVO98412.1\|3849_4086_-	mercury resistance protein	NA	NA	NA	NA
AVO98413.1\|4082_4448_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
AVO98414.1\|4465_6163_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	5.1e-39	27.5

DBSCAN-SWA_2

11267 : 25641

Aeromonas_phage(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98422.1\|11267_12221_-\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	9.5e-75	57.1
AVO98423.1\|12341_12608_-	hypothetical protein	NA	NA	NA	NA
AVO98424.1\|12627_13248_-	serine recombinase	A0A219Y912	Aeromonas_phage	1.0e-08	31.0
AVO98520.1\|13845_14472_+	ParA family protein	A0A2H4EW66	Aeromonas_phage	4.5e-25	34.4
AVO98425.1\|14516_14744_+	hypothetical protein	NA	NA	NA	NA
AVO98426.1\|14918_16193_-	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.3e-148	60.7
AVO98521.1\|16204_16654_-	peptidase	A0A1W6JNS2	Morganella_phage	2.3e-31	52.0
AVO98427.1\|16650_16896_-	DinI family protein	Q7Y3V9	Yersinia_phage	1.1e-08	39.3
AVO98428.1\|17099_17330_+	hypothetical protein	NA	NA	NA	NA
AVO98429.1\|17764_18466_+	DNA methylase	A0A2K9VH43	Faecalibacterium_phage	6.2e-23	34.7
AVO98430.1\|18465_18687_+	hypothetical protein	NA	NA	NA	NA
AVO98431.1\|18732_19143_+	DUF1380 domain-containing protein	NA	NA	NA	NA
AVO98523.1\|19189_19957_+	hypothetical protein	NA	NA	NA	NA
AVO98522.1\|20381_20810_+	antirestriction protein	NA	NA	NA	NA
AVO98432.1\|20855_21362_+	antirestriction protein	G9FHQ1	Rhodococcus_virus	2.6e-07	31.3
AVO98433.1\|21404_21596_+	hypothetical protein	NA	NA	NA	NA
AVO98434.1\|21755_22166_+	DNA polymerase III subunit theta	NA	NA	NA	NA
AVO98435.1\|22716_23274_+	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	1.8e-49	73.2
AVO98436.1\|23322_23571_+	DUF905 domain-containing protein	NA	NA	NA	NA
AVO98437.1\|23640_25641_+	hypothetical protein	G8DH78	Emiliania_huxleyi_virus	6.7e-22	26.9

DBSCAN-SWA_3

30272 : 30611

Klebsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98445.1\|30272_30611_+	hypothetical protein	A0A248SL90	Klebsiella_phage	1.9e-22	53.5

DBSCAN-SWA_4

61183 : 71036

Virus_Rctr197k(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98482.1\|61183_66442_+	conjugative transfer relaxase/helicase TraI	A0A1P8DII4	Virus_Rctr197k	1.0e-05	33.8
AVO98483.1\|66522_67248_+	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	5.5e-06	28.8
AVO98484.1\|67319_67913_+	conjugal transfer protein	NA	NA	NA	NA
AVO98485.1\|68079_68676_+	hypothetical protein	NA	NA	NA	NA
AVO98486.1\|68725_69370_+	hypothetical protein	NA	NA	NA	NA
AVO98487.1\|69425_70076_+	DUF2726 domain-containing protein	NA	NA	NA	NA
AVO98488.1\|70072_70381_+	hypothetical protein	K7PKY8	Enterobacterial_phage	1.1e-08	31.7
AVO98528.1\|70484_71036_+	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	6.2e-18	33.1

DBSCAN-SWA_5

74619 : 75615

Thermus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98493.1\|74619_75615_-\|transposase	IS110 family transposase	A0A1S7J231	Thermus_phage	4.1e-20	27.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP027616

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20558 : 91637

Escherichia_phage(23.53%)

integrase,transposase

attL 44849:44908|attR 93467:93483

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98785.1\|20558_21482_-\|transposase	IS5-like element IS903B family transposase	Q9MCT5	Escherichia_phage	4.1e-176	98.7
AVO98676.1\|23337_23586_-	DUF905 domain-containing protein	NA	NA	NA	NA
AVO98677.1\|23635_24193_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	1.8e-49	72.4
AVO98678.1\|24223_24373_-	single-stranded DNA-binding protein	NA	NA	NA	NA
AVO98679.1\|24993_25314_-	hypothetical protein	NA	NA	NA	NA
AVO98680.1\|25338_25602_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	1.4e-12	50.0
AVO98681.1\|25789_25981_-	hypothetical protein	NA	NA	NA	NA
AVO98682.1\|26023_26530_-	antirestriction protein	G9FHQ1	Rhodococcus_virus	1.2e-07	31.4
AVO98683.1\|26572_27001_-	antirestriction protein	A9J566	Pseudomonas_phage	2.2e-10	31.9
AVO98684.1\|27681_28449_-	hypothetical protein	NA	NA	NA	NA
AVO98685.1\|28502_28922_-	DUF1380 domain-containing protein	NA	NA	NA	NA
AVO98686.1\|28931_29153_-	hypothetical protein	NA	NA	NA	NA
AVO98687.1\|29152_29854_-	DNA methylase	A0A2I7RE86	Vibrio_phage	7.1e-27	36.7
AVO98688.1\|30290_30521_-	hypothetical protein	NA	NA	NA	NA
AVO98689.1\|30582_31254_-	Mediator of plasmid stability	NA	NA	NA	NA
AVO98690.1\|31256_32228_-	StbA family protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
AVO98691.1\|32460_32892_+	peptidase	A0A1W6JNS2	Morganella_phage	3.6e-29	53.3
AVO98692.1\|32891_34163_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	1.6e-149	63.5
AVO98693.1\|34244_35222_-	ParB/RepB/Spo0J family partition protein	A0A1B0V750	Salmonella_phage	9.4e-86	55.0
AVO98694.1\|35218_36424_-	ParA family protein	A0A077SL49	Escherichia_phage	4.0e-163	69.6
AVO98695.1\|37205_37610_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	1.6e-68	97.8
AVO98696.1\|37606_37954_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZDM8	Stx2-converting_phage	2.6e-62	100.0
AVO98697.1\|38002_39541_+\|transposase	IS66-like element ISKpn24 family transposase	A0A0P0ZEB3	Stx2-converting_phage	4.6e-281	94.7
AVO98698.1\|39628_40384_-	replication initiation protein RepE	I3WF20	Macacine_betaherpesvirus	1.7e-135	95.2
AVO98699.1\|40631_40817_-	hypothetical protein	NA	NA	NA	NA
AVO98700.1\|41256_41514_+	hypothetical protein	NA	NA	NA	NA
AVO98786.1\|41571_42348_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	1.9e-52	92.0
AVO98701.1\|42359_42998_-	hypothetical protein	NA	NA	NA	NA
AVO98702.1\|43911_44142_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AVO98703.1\|44138_44555_+	PIN domain nuclease	NA	NA	NA	NA
AVO98704.1\|44628_44865_+	hypothetical protein	NA	NA	NA	NA
44849:44908	attL	NA	NA	NA	NA
AVO98705.1\|44911_45616_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
44849:44908	attL	NA	NA	NA	NA
AVO98706.1\|45506_46436_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.5e-45	40.1
AVO98707.1\|46582_47065_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	6.6e-16	28.9
AVO98708.1\|47285_47552_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AVO98709.1\|47694_48459_+\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AVO98710.1\|48500_48713_+	resolvase	NA	NA	NA	NA
AVO98711.1\|48725_49934_+	restriction endonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
AVO98712.1\|49967_51401_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
AVO98713.1\|51782_51989_-	hypothetical protein	NA	NA	NA	NA
AVO98787.1\|51993_52482_-	restriction endonuclease	NA	NA	NA	NA
AVO98714.1\|52690_53002_-	hypothetical protein	NA	NA	NA	NA
AVO98788.1\|53037_53343_-	IncN plasmid KikA protein	NA	NA	NA	NA
AVO98715.1\|53378_54083_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
53316:53972	attR	NA	NA	NA	NA
AVO98716.1\|55979_56984_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
53316:53972	attR	NA	NA	NA	NA
AVO98717.1\|57165_57342_-	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
AVO98718.1\|57671_58487_+	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AVO98719.1\|58547_59351_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AVO98720.1\|59350_60187_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AVO98721.1\|60158_60698_-\|transposase	IS91 family transposase	NA	NA	NA	NA
AVO98722.1\|60907_61768_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
AVO98723.1\|62467_63292_-	oxacillin-hydrolyzing class D beta-lactamase OXA-9	NA	NA	NA	NA
AVO98724.1\|63351_64140_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AVO98789.1\|64209_64764_-	AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase	NA	NA	NA	NA
AVO98725.1\|64997_65555_-	recombinase	Q1MVP4	Enterobacteria_phage	2.0e-93	98.4
AVO98726.1\|66669_68385_-\|integrase	integrase	NA	NA	NA	NA
AVO98727.1\|68494_71524_+\|transposase	IS3-like element Tn4401 family transposase	NA	NA	NA	NA
AVO98728.1\|71630_72656_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.4e-87	50.3
AVO98729.1\|72652_73432_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	2.5e-89	61.8
AVO98730.1\|73750_74632_+	carbapenem-hydrolyzing class A beta-lactamase KPC-3	A0A1B0VBP7	Salmonella_phage	2.8e-73	52.2
AVO98731.1\|74881_76201_-\|transposase	IS1182 family transposase ISKpn6	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AVO98732.1\|77112_77484_+	hypothetical protein	NA	NA	NA	NA
AVO98733.1\|77546_78467_+	hypothetical protein	NA	NA	NA	NA
AVO98734.1\|78520_79279_+	Tat pathway signal sequence	NA	NA	NA	NA
AVO98735.1\|79512_80811_+	MFS transporter	NA	NA	NA	NA
AVO98736.1\|80916_81186_+	metal resistance protein	NA	NA	NA	NA
AVO98737.1\|81198_82329_+	nickel/cobalt efflux protein RcnA	NA	NA	NA	NA
AVO98738.1\|82502_82913_+	hypothetical protein	NA	NA	NA	NA
AVO98739.1\|83001_83124_-	plasmid mobilization protein	NA	NA	NA	NA
AVO98740.1\|83168_84509_-\|transposase	transposase	NA	NA	NA	NA
AVO98741.1\|84597_86130_+\|transposase	IS3 family transposase ISKpn38	A0A1B1P773	Bacillus_phage	3.1e-51	39.8
AVO98790.1\|86563_88687_-	hypothetical protein	NA	NA	NA	NA
AVO98742.1\|89051_90092_-	ATP-binding protein	M4QMW8	Micromonas_pusilla_virus	9.5e-20	35.2
AVO98743.1\|90261_91637_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.4e-79	74.1
93467:93483	attR	NA	NA	NA	NA

DBSCAN-SWA_2

104590 : 111017

Yersinia_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO98761.1\|104590_104836_+	DinI family protein	Q7Y3V9	Yersinia_phage	1.5e-08	39.3
AVO98793.1\|104832_105282_+	peptidase	A0A1W6JNS2	Morganella_phage	5.2e-31	52.0
AVO98762.1\|105293_106565_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	7.3e-147	60.5
AVO98763.1\|106666_106867_+	hypothetical protein	NA	NA	NA	NA
AVO98764.1\|107067_107343_-	hypothetical protein	NA	NA	NA	NA
AVO98765.1\|107333_107981_-	chromosome partitioning protein ParA	A0A222YXS3	Escherichia_phage	9.7e-39	43.5
AVO98766.1\|108310_108829_-	hypothetical protein	NA	NA	NA	NA
AVO98767.1\|109252_109477_+	hypothetical protein	NA	NA	NA	NA
AVO98768.1\|109368_109956_+	recombinase family protein	A0A219Y912	Aeromonas_phage	2.6e-22	36.5
AVO98769.1\|110063_111017_+\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	1.4e-62	49.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. CP027612

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

439615 : 446519

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO93713.1\|439615_441094_+	two-component system sensor histidine kinase BaeA	W8CYF6	Bacillus_phage	8.5e-30	28.3
AVO93714.1\|441090_441813_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
AVO93715.1\|442131_443493_+	U32 family peptidase	Q6DW11	Phage_TP	1.8e-207	94.8
AVO98005.1\|443738_444632_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	6.1e-15	29.8
AVO93716.1\|444871_445645_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.9e-26	36.7
AVO98006.1\|445655_446519_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5

DBSCAN-SWA_2

645551 : 732484

Klebsiella_phage(33.33%)

portal,holin,tail,tRNA,head,protease,capsid,integrase,terminase

attL 668279:668306|attR 709455:709482

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO93882.1\|645551_646364_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AVO93883.1\|646363_647377_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AVO93884.1\|647440_648577_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	1.6e-20	27.8
AVO93885.1\|648687_649665_+	flagella biosynthesis regulator Flk	NA	NA	NA	NA
AVO93886.1\|649751_650927_-	arabinose transporter	NA	NA	NA	NA
AVO93887.1\|651136_652357_-	beta-ketoacyl-[acyl-carrier-protein] synthase I	NA	NA	NA	NA
AVO98016.1\|652515_654504_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
AVO98017.1\|654565_654847_-	YfcL family protein	NA	NA	NA	NA
AVO93888.1\|654878_655427_-	elongation factor P hydroxylase	NA	NA	NA	NA
AVO93889.1\|655426_656236_-	hypothetical protein	NA	NA	NA	NA
AVO93890.1\|656235_657057_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
AVO93891.1\|657059_658145_-	chorismate synthase	A0A291AU41	Pandoravirus	4.5e-89	46.6
AVO93892.1\|658186_659119_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AVO93893.1\|659286_659838_+	endonuclease SmrB	NA	NA	NA	NA
AVO93894.1\|659858_660344_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
AVO93895.1\|660553_662698_-	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
AVO93896.1\|662697_664008_-	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
AVO93897.1\|664167_664452_-	DUF406 domain-containing protein	NA	NA	NA	NA
AVO93898.1\|664819_666148_+	long-chain fatty acid transporter FadL	NA	NA	NA	NA
AVO93899.1\|666209_666971_-	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AVO93900.1\|667260_668190_+	hypothetical protein	E7DYY8	Enterobacteria_phage	4.4e-133	81.1
668279:668306	attL	NA	NA	NA	NA
AVO93901.1\|668934_669180_+	hypothetical protein	NA	NA	NA	NA
AVO93902.1\|669612_669939_-	hypothetical protein	K7PGV5	Enterobacterial_phage	9.6e-27	51.9
AVO93903.1\|669938_670178_-	hypothetical protein	K7P7N3	Enterobacteria_phage	6.1e-15	51.9
AVO93904.1\|673957_677029_-	kinase	A0A286S259	Klebsiella_phage	0.0e+00	98.0
AVO93905.1\|677025_677406_-	nitrite transporter	A0A286S2A6	Klebsiella_phage	2.8e-70	96.0
AVO93906.1\|677415_677898_-	ArsR family transcriptional regulator	A0A286S2B1	Klebsiella_phage	6.7e-85	97.5
AVO93907.1\|677884_678364_-	hypothetical protein	A0A286S298	Klebsiella_phage	3.9e-93	98.1
AVO93908.1\|678363_680811_-\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	2.0e-278	66.6
AVO93909.1\|680855_681323_-	hypothetical protein	NA	NA	NA	NA
AVO93910.1\|681388_681652_-\|tail	phage tail protein	A0A286S1P2	Klebsiella_phage	5.9e-43	98.8
AVO93911.1\|681684_682038_-\|tail	phage tail protein	A0A286S1N4	Klebsiella_phage	4.9e-61	99.1
AVO93912.1\|682081_682573_-\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	8.6e-88	99.4
AVO93913.1\|682629_682995_-	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.9e-61	92.6
AVO93914.1\|682991_683531_-	hypothetical protein	A0A286S249	Klebsiella_phage	1.0e-94	100.0
AVO93915.1\|683523_683856_-\|head,tail	head-tail adaptor protein	A0A286S2A2	Klebsiella_phage	3.1e-57	100.0
AVO93916.1\|683857_684055_-	hypothetical protein	A0A286S2A5	Klebsiella_phage	2.4e-25	96.9
AVO93917.1\|684124_684442_-\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	1.2e-21	52.0
AVO93918.1\|684519_685758_-\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	4.7e-159	70.1
AVO93919.1\|685767_686367_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-90	82.5
AVO93920.1\|686359_687586_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	2.5e-208	85.0
AVO93921.1\|687733_689485_-\|terminase	terminase large subunit	A0A1B5FP96	Escherichia_phage	9.7e-251	71.6
AVO93922.1\|689488_689986_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	7.4e-63	71.3
AVO93923.1\|690144_690495_-	HNH endonuclease	A0A1B5FP94	Escherichia_phage	1.2e-51	80.9
AVO93924.1\|690556_690802_-	DUF2560 domain-containing protein	A0A286N2R1	Klebsiella_phage	2.1e-34	97.5
AVO93925.1\|691204_691399_-	hypothetical protein	A0A1L6Z528	Klebsiella_phage	4.3e-19	73.3
AVO93926.1\|691466_691712_-	hypothetical protein	NA	NA	NA	NA
AVO93927.1\|691773_691953_-	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.9e-21	87.3
AVO93928.1\|691903_692179_-	hypothetical protein	G8C7W1	Escherichia_phage	6.0e-06	37.1
AVO93929.1\|692181_692811_-	endolysin	F1C591	Cronobacter_phage	8.4e-88	75.4
AVO93930.1\|692810_693092_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	4.8e-19	48.4
AVO93931.1\|693078_693465_-	hypothetical protein	A0A192Y8P2	Salmonella_phage	1.6e-57	90.6
AVO93932.1\|693674_694079_-	antitermination protein	S5M7R9	Escherichia_phage	5.5e-32	54.0
AVO93933.1\|694068_694713_-	DNA methyltransferase	I6PDF5	Cronobacter_phage	3.4e-84	68.2
AVO93934.1\|694709_695354_-	NinG family protein	A0A1W6JNX3	Morganella_phage	1.9e-39	54.3
AVO93935.1\|695323_696295_-	DNA primase	A0A286N2Q0	Klebsiella_phage	1.6e-109	61.1
AVO93936.1\|696291_697821_-	ATP-dependent helicase	A0A286N2P9	Klebsiella_phage	5.1e-203	66.9
AVO93937.1\|697813_698089_-	hypothetical protein	NA	NA	NA	NA
AVO93938.1\|698250_698529_-	hypothetical protein	NA	NA	NA	NA
AVO93939.1\|698571_699102_-	DNA-binding protein	A0A1C9II13	Salmonella_phage	7.9e-55	61.8
AVO93940.1\|699130_699391_-	hypothetical protein	A0A1B5FPK9	Escherichia_phage	1.2e-08	42.0
AVO98018.1\|699496_700201_+	helix-turn-helix domain-containing protein	G8C7U1	Escherichia_phage	3.7e-68	60.1
AVO93941.1\|700258_701293_+	hypothetical protein	A4KWR9	Enterobacteria_phage	3.9e-74	43.2
AVO93942.1\|701330_701537_-	hypothetical protein	K7P7I0	Enterobacteria_phage	5.1e-10	56.7
AVO93943.1\|702292_702805_-	hypothetical protein	NA	NA	NA	NA
AVO93944.1\|703253_703613_+	hypothetical protein	NA	NA	NA	NA
AVO93945.1\|703656_704469_+	hypothetical protein	NA	NA	NA	NA
AVO93946.1\|704550_705411_+	DNA-binding protein	A0A2H4J902	uncultured_Caudovirales_phage	1.0e-72	55.1
AVO93947.1\|705600_705729_+\|integrase	integrase	NA	NA	NA	NA
AVO93948.1\|705725_705950_+	hypothetical protein	S4TVX5	Salmonella_phage	3.2e-13	50.8
AVO93949.1\|705942_706230_+	hypothetical protein	NA	NA	NA	NA
AVO98019.1\|706526_706835_+	hypothetical protein	Q5G8V2	Enterobacteria_phage	3.4e-18	72.1
AVO93950.1\|706842_707028_+	hypothetical protein	G3CFG7	Escherichia_phage	3.8e-12	60.0
AVO93951.1\|707143_707869_-	hypothetical protein	NA	NA	NA	NA
AVO93952.1\|708090_709260_-\|integrase	integrase	A0A2R2Z2Y0	Escherichia_phage	5.6e-202	85.8
AVO93953.1\|709778_710261_+	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
709455:709482	attR	NA	NA	NA	NA
AVO93954.1\|710628_711510_+	hypothetical protein	A0A2H4JEC4	uncultured_Caudovirales_phage	1.5e-05	56.8
AVO93955.1\|711519_712428_-	transcriptional regulator CynR	A0A2P0ZL89	Lactobacillus_phage	7.8e-10	24.2
AVO93956.1\|712560_713019_+	nucleoside deaminase	A0A0B5J096	Pandoravirus	1.2e-11	32.3
AVO93957.1\|713015_714212_+	cyanate transporter	NA	NA	NA	NA
AVO98020.1\|714550_714622_+	membrane protein YpdK	NA	NA	NA	NA
AVO93958.1\|714692_715907_-	alanine transaminase	NA	NA	NA	NA
AVO93959.1\|715995_716181_+	phytanoyl-CoA dioxygenase	NA	NA	NA	NA
AVO93960.1\|716289_717987_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	6.7e-47	28.5
AVO98021.1\|717998_718736_+	DNA-binding response regulator	A0A2R2ZGH8	Clostridioides_phage	1.5e-14	26.3
AVO93961.1\|718789_719755_-	glucokinase	NA	NA	NA	NA
AVO93962.1\|720018_721254_+	ion channel protein	NA	NA	NA	NA
AVO98022.1\|721250_722912_-	indolepyruvate decarboxylase	NA	NA	NA	NA
AVO93963.1\|723092_724085_+	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
AVO93964.1\|724215_724575_+	DUF2502 domain-containing protein	NA	NA	NA	NA
AVO93965.1\|724632_725874_-	divalent metal cation transporter	NA	NA	NA	NA
AVO93966.1\|726220_727423_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
AVO93967.1\|727471_729643_-	hypothetical protein	NA	NA	NA	NA
AVO93968.1\|730264_730618_+	hypothetical protein	NA	NA	NA	NA
AVO93969.1\|730621_731014_+	hypothetical protein	NA	NA	NA	NA
AVO93970.1\|731065_732484_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_3

787707 : 861988

Salmonella_phage(54.35%)

holin,transposase,tRNA,tail,protease,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO94024.1\|787707_789711_-\|tRNA	tRNA cytosine(34) acetyltransferase TmcA	NA	NA	NA	NA
AVO94025.1\|789720_790596_-	neutral zinc metallopeptidase	NA	NA	NA	NA
AVO94026.1\|790715_791429_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A127KMU1	Cyanophage	1.1e-38	35.7
AVO94027.1\|791644_792679_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
AVO94028.1\|792695_793574_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
AVO94029.1\|793661_794294_+	glycine cleavage system transcriptional repressor	NA	NA	NA	NA
AVO94030.1\|794297_794768_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
AVO94031.1\|794829_795891_-	AI-2E family transporter	NA	NA	NA	NA
AVO94032.1\|796113_797577_+\|protease	beta-barrel assembly-enhancing protease	NA	NA	NA	NA
AVO94033.1\|797586_797946_+	arsenate reductase (glutaredoxin)	NA	NA	NA	NA
AVO94034.1\|798073_798985_+\|transposase	ISNCY family transposase	Q2A0A7	Sodalis_phage	3.5e-74	58.8
AVO94035.1\|798981_799683_-	DnaA inactivator Hda	NA	NA	NA	NA
AVO94036.1\|799781_801068_-	uracil permease	Q9KX94	Enterobacteria_phage	4.1e-65	37.9
AVO94037.1\|801163_801790_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
AVO94038.1\|802007_803441_-	6-phospho-beta-glucosidase	NA	NA	NA	NA
AVO94039.1\|803450_804344_-	beta-glucoside kinase	NA	NA	NA	NA
AVO94040.1\|804607_805645_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	8.2e-72	44.5
AVO94041.1\|805641_806283_+	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.2e-28	41.1
AVO94042.1\|806463_808524_+	polyphosphate kinase 1	NA	NA	NA	NA
AVO94043.1\|808527_810060_+	exopolyphosphatase	NA	NA	NA	NA
AVO94044.1\|810113_812342_-	sensor domain-containing phosphodiesterase	NA	NA	NA	NA
AVO94045.1\|812694_812886_+	DUF2633 domain-containing protein	G9L6F2	Escherichia_phage	3.3e-19	79.3
AVO94046.1\|812982_813870_-	LysR family transcriptional regulator	NA	NA	NA	NA
AVO94047.1\|813967_815200_+	MFS transporter	NA	NA	NA	NA
AVO94048.1\|816270_817449_+	anaerobic sulfatase maturase	NA	NA	NA	NA
AVO94049.1\|817432_819301_+	phosphatase	A0A2P0VMN7	Tetraselmis_virus	2.6e-07	22.6
AVO94050.1\|819487_820003_-	DUF2514 domain-containing protein	Q858E9	Salmonella_phage	1.4e-69	88.8
AVO94051.1\|819999_820629_-	endolysin	Q858F0	Salmonella_phage	7.4e-92	77.4
AVO94052.1\|820618_820924_-\|holin	phage holin family protein	A0A193GYK3	Enterobacter_phage	6.0e-39	80.4
AVO94053.1\|820910_821315_-	hypothetical protein	T1SA79	Salmonella_phage	9.3e-56	84.1
AVO94054.1\|821567_821789_-	hypothetical protein	NA	NA	NA	NA
AVO94055.1\|821790_822534_-	hypothetical protein	NA	NA	NA	NA
AVO94056.1\|824535_824832_+	hypothetical protein	T1SA06	Salmonella_phage	8.1e-25	65.5
AVO94057.1\|824960_825296_+	hypothetical protein	NA	NA	NA	NA
AVO94058.1\|825219_825765_+	DUF2335 domain-containing protein	NA	NA	NA	NA
AVO94059.1\|825856_826009_+	transmembrane anchored protein	G9L6D9	Escherichia_phage	5.6e-14	83.7
AVO94060.1\|826043_826373_-	hypothetical protein	NA	NA	NA	NA
AVO94061.1\|826369_829144_-	hypothetical protein	Q858F8	Salmonella_phage	0.0e+00	78.2
AVO94062.1\|829143_831021_-	hypothetical protein	Q858F9	Salmonella_phage	9.0e-194	58.0
AVO94063.1\|831020_833537_-	hypothetical protein	Q858G0	Salmonella_phage	1.2e-246	53.0
AVO94064.1\|833549_834047_-	hypothetical protein	A0A0F6TJ56	Escherichia_coli_O157_typing_phage	5.7e-23	40.5
AVO94065.1\|834039_834510_-	hypothetical protein	Q858G2	Salmonella_phage	7.3e-44	55.3
AVO94066.1\|834511_836989_-	hypothetical protein	G9L6D0	Escherichia_phage	6.2e-267	56.6
AVO94067.1\|836988_837600_-	hypothetical protein	T1SAQ2	Salmonella_phage	9.2e-47	48.8
AVO94068.1\|837648_837927_-	hypothetical protein	T1SA01	Salmonella_phage	1.1e-20	58.9
AVO94069.1\|837919_838312_-	hypothetical protein	T1SA71	Salmonella_phage	1.5e-55	89.9
AVO94070.1\|838321_839329_-\|capsid	phage capsid protein	T1S9H9	Salmonella_phage	4.7e-181	92.5
AVO94071.1\|839341_839740_-	peptidase	T1SAP9	Salmonella_phage	5.6e-37	59.5
AVO94072.1\|839781_839979_-	hypothetical protein	NA	NA	NA	NA
AVO94073.1\|840021_840327_-	hypothetical protein	Q2A090	Sodalis_phage	8.4e-17	51.3
AVO94074.1\|840323_842003_-\|tail	phage tail protein	T1S9Z7	Salmonella_phage	3.6e-194	59.3
AVO94075.1\|842006_842210_-	hypothetical protein	NA	NA	NA	NA
AVO98025.1\|842231_842420_-	hypothetical protein	NA	NA	NA	NA
AVO94076.1\|843010_843802_+	hypothetical protein	NA	NA	NA	NA
AVO94077.1\|843798_845274_-\|terminase	terminase	Q858H3	Salmonella_phage	5.4e-279	92.4
AVO94078.1\|845270_845855_-\|terminase	terminase small subunit	T1SBI8	Salmonella_phage	2.2e-90	88.6
AVO98026.1\|845932_846190_-	lF-82	NA	NA	NA	NA
AVO94079.1\|846264_846603_-	hypothetical protein	A0A193GYX4	Enterobacter_phage	1.8e-44	80.0
AVO94080.1\|846595_846844_-	hypothetical protein	NA	NA	NA	NA
AVO94081.1\|847465_847657_-	hypothetical protein	NA	NA	NA	NA
AVO94082.1\|847656_848160_-	hypothetical protein	K7PJQ4	Enterobacteria_phage	6.9e-08	34.3
AVO94083.1\|848156_848561_-	hypothetical protein	NA	NA	NA	NA
AVO94084.1\|848557_848953_-	hypothetical protein	R9TME7	Aeromonas_phage	2.2e-09	40.2
AVO94085.1\|849617_850388_-	DNA replication domain protein	G9L6A8	Escherichia_phage	5.5e-57	91.7
AVO94086.1\|850377_851463_-	DNA cytosine methyltransferase	Q858D4	Salmonella_phage	2.8e-139	65.7
AVO94087.1\|851459_851663_-	hypothetical protein	Q858D5	Salmonella_phage	2.3e-23	82.1
AVO94088.1\|851809_852043_-	hypothetical protein	T1SAR5	Salmonella_phage	9.2e-24	66.2
AVO94089.1\|852197_852779_+	XRE family transcriptional regulator	Q858D7	Salmonella_phage	7.1e-65	64.3
AVO94090.1\|853143_853443_+	hypothetical protein	A0A0F6R7M4	Escherichia_coli_O157_typing_phage	8.8e-19	52.5
AVO94091.1\|853439_854261_+	exodeoxyribonuclease VIII	A0A193GYK2	Enterobacter_phage	9.5e-132	81.3
AVO94092.1\|854257_855139_+	recombinase RecT	T1SBJ5	Salmonella_phage	4.0e-136	84.6
AVO94093.1\|855187_855436_+	AlpA family phage regulatory protein	A0A0F6TJ45	Escherichia_coli_O157_typing_phage	2.8e-31	78.0
AVO94094.1\|855545_855839_+	PerC family transcriptional regulator	T1S9J5	Salmonella_phage	4.0e-32	71.1
AVO94095.1\|855831_855990_+	DUF1317 domain-containing protein	T1SAR0	Salmonella_phage	5.6e-17	75.0
AVO94096.1\|855986_856640_+	hypothetical protein	M1F3E2	Salmonella_phage	4.8e-70	64.2
AVO94097.1\|856636_857230_+	adenine methylase	T1SA14	Salmonella_phage	1.6e-109	91.9
AVO94098.1\|857226_857418_+	hypothetical protein	NA	NA	NA	NA
AVO94099.1\|857434_858685_-	DUF4102 domain-containing protein	A0A1X9TCT6	Enterobacter_phage	1.8e-206	85.3
AVO94100.1\|858876_860454_-	GMP synthase (glutamine-hydrolyzing)	NA	NA	NA	NA
AVO94101.1\|860521_861988_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.2e-87	38.7

DBSCAN-SWA_4

3773756 : 3783219

Dickeya_phage(16.67%)

protease,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO96753.1\|3773756_3774872_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
AVO96754.1\|3774868_3776809_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	2.5e-37	40.5
AVO96755.1\|3776748_3776931_+	hypothetical protein	NA	NA	NA	NA
AVO96756.1\|3776885_3777107_-	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
AVO96757.1\|3777432_3777750_+\|protease	ATP-dependent Clp protease adaptor ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
AVO96758.1\|3777780_3780060_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
AVO96759.1\|3780179_3780398_-	translation initiation factor IF-1	NA	NA	NA	NA
AVO96760.1\|3780751_3781453_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
AVO96761.1\|3781497_3783219_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	1.2e-14	34.3

DBSCAN-SWA_5

4009443 : 4090147

101

Enterobacterial_phage(16.33%)

portal,holin,transposase,tRNA,tail,integrase,head,protease,capsid,terminase

attL 4001395:4001412|attR 4097601:4097618

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4001395:4001412	attL	NA	NA	NA	NA
AVO96953.1\|4009443_4009935_+\|transposase	transposase	NA	NA	NA	NA
AVO96954.1\|4010072_4011194_-	cupin domain-containing protein	NA	NA	NA	NA
AVO96955.1\|4011279_4012746_-	two-component system sensor histidine kinase PhoQ	NA	NA	NA	NA
AVO96956.1\|4012745_4013417_-	two-component system response regulator PhoP	NA	NA	NA	NA
AVO96957.1\|4013699_4014506_+	AraC family transcriptional regulator	NA	NA	NA	NA
AVO96958.1\|4014589_4014952_+	cupin domain-containing protein	NA	NA	NA	NA
AVO96959.1\|4015006_4016377_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-107	45.1
AVO96960.1\|4016380_4017022_-	lysogenization regulator HflD	NA	NA	NA	NA
AVO98153.1\|4017076_4018183_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
AVO96961.1\|4018239_4018698_-	NUDIX hydrolase	NA	NA	NA	NA
AVO96962.1\|4018714_4019365_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
AVO96963.1\|4019605_4020856_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6
AVO96964.1\|4020968_4022111_-\|integrase	integrase	Q77Z02	Phage_21	9.1e-173	82.2
AVO96965.1\|4022100_4022337_-	excisionase	NA	NA	NA	NA
AVO96966.1\|4022365_4022638_-	hypothetical protein	K7PKM4	Enterobacterial_phage	1.7e-08	39.4
AVO96967.1\|4022637_4022856_-	hypothetical protein	NA	NA	NA	NA
AVO96968.1\|4022848_4023427_-	DUF551 domain-containing protein	R9TQX3	Aeromonas_phage	2.1e-21	37.4
AVO96969.1\|4023423_4023696_-	hypothetical protein	K7PMC8	Enterobacterial_phage	2.5e-36	84.4
AVO96970.1\|4023697_4024150_-	hypothetical protein	NA	NA	NA	NA
AVO96971.1\|4024797_4025583_-	hypothetical protein	C7BGF1	Burkholderia_phage	3.1e-63	52.9
AVO96972.1\|4025582_4025882_-	hypothetical protein	K7PJS4	Enterobacterial_phage	1.2e-12	46.7
AVO96973.1\|4026354_4027509_-	type I restriction endonuclease subunit R	A0A1S5SAB0	Streptococcus_phage	1.5e-34	28.2
AVO96974.1\|4027680_4028157_-	hypothetical protein	A0A2D1GNH0	Pseudomonas_phage	1.1e-12	45.3
AVO96975.1\|4028258_4028522_+	Cro/Cl family transcriptional regulator	D0UIL8	Aggregatibacter_phage	3.7e-13	47.9
AVO96976.1\|4028550_4029003_+	hypothetical protein	K7PJS5	Enterobacterial_phage	1.5e-67	87.8
AVO96977.1\|4029240_4029420_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	4.6e-15	73.1
AVO96978.1\|4029409_4030378_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	2.4e-97	71.3
AVO96979.1\|4030374_4031184_+	DNA methylase	A0A1C9II58	Salmonella_phage	1.2e-110	69.7
AVO96980.1\|4031193_4031571_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	1.9e-47	72.8
AVO96981.1\|4031583_4032564_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	4.2e-134	66.9
AVO96982.1\|4032582_4032924_+	antitermination protein	A0A0P0ZCW0	Stx2-converting_phage	3.5e-56	87.6
AVO96983.1\|4032972_4033458_-	hypothetical protein	NA	NA	NA	NA
AVO96984.1\|4033482_4034304_-	hypothetical protein	NA	NA	NA	NA
AVO96985.1\|4035484_4035754_+\|holin	holin	K7P6H9	Enterobacteria_phage	2.8e-32	78.3
AVO98154.1\|4035731_4036229_+	lysozyme	A0A1V0E5Q7	Salmonella_phage	9.6e-79	83.6
AVO96986.1\|4036225_4036615_+	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	1.5e-23	50.0
AVO96987.1\|4036607_4036757_+	Rz1 lytic protein	S5FXQ4	Shigella_phage	1.1e-09	71.4
AVO96988.1\|4036880_4037201_+	hypothetical protein	NA	NA	NA	NA
AVO96989.1\|4037203_4037554_+	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.2e-51	80.2
AVO96990.1\|4037711_4038209_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	1.9e-63	72.0
AVO96991.1\|4038212_4039964_+\|terminase	terminase large subunit	A0A1P8DTK0	Proteus_phage	5.2e-252	72.2
AVO96992.1\|4040111_4041338_+\|portal	phage portal protein	Q8SBI0	Shigella_phage	7.1e-208	85.0
AVO96993.1\|4041330_4041930_+\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	1.0e-90	82.5
AVO96994.1\|4041939_4043178_+\|capsid	phage major capsid protein	Q8SBH8	Shigella_phage	5.2e-158	69.4
AVO96995.1\|4043255_4043573_+\|head,tail	phage gp6-like head-tail connector protein	A0A1W6JNZ5	Morganella_phage	7.4e-24	52.9
AVO96996.1\|4043581_4043920_+\|head,tail	head-tail adaptor protein	A0A2H4JHK5	uncultured_Caudovirales_phage	5.1e-39	68.8
AVO96997.1\|4043916_4044366_+	hypothetical protein	Q9MCS9	Enterobacteria_phage	1.5e-62	81.9
AVO96998.1\|4044362_4044710_+	DUF3168 domain-containing protein	K7PKL6	Enterobacterial_phage	2.8e-32	63.7
AVO96999.1\|4044766_4045471_+\|tail	phage tail protein	K7PHL2	Enterobacterial_phage	5.5e-80	66.9
AVO97000.1\|4045501_4045906_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	8.5e-33	57.7
AVO97001.1\|4045908_4046214_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	4.7e-28	64.6
AVO97002.1\|4046287_4046521_+	hypothetical protein	K7PH16	Enterobacteria_phage	1.4e-08	47.2
AVO97003.1\|4046581_4049968_+\|tail	phage tail tape measure protein	A0A0P0ZCJ4	Stx2-converting_phage	1.6e-305	58.2
AVO97004.1\|4049988_4050462_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.6e-54	61.4
AVO97005.1\|4050448_4050934_+	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	3.0e-53	66.2
AVO97006.1\|4050943_4051324_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	2.1e-57	80.2
AVO97007.1\|4051320_4054404_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	71.9
AVO97008.1\|4054464_4056684_+	hypothetical protein	NA	NA	NA	NA
AVO97009.1\|4056693_4056915_+	DUF2829 domain-containing protein	NA	NA	NA	NA
AVO97010.1\|4056952_4057174_-	hypothetical protein	NA	NA	NA	NA
AVO97011.1\|4057175_4058957_-	hypothetical protein	NA	NA	NA	NA
AVO97012.1\|4059149_4059698_+	recombinase family protein	A0A286S1P7	Klebsiella_phage	1.5e-88	91.7
AVO97013.1\|4059775_4060198_+	hypothetical protein	K7P834	Enterobacteria_phage	2.8e-26	45.3
AVO97014.1\|4060609_4060849_+	DNA polymerase V	I6PD82	Cronobacter_phage	9.8e-21	54.4
AVO97015.1\|4060805_4061177_+	hypothetical protein	K7PGV5	Enterobacterial_phage	1.4e-26	50.9
AVO97016.1\|4061355_4061508_+	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
AVO97017.1\|4061780_4062494_-	transcriptional regulator	NA	NA	NA	NA
AVO97018.1\|4062490_4062883_-	amino acid-binding protein	NA	NA	NA	NA
AVO97019.1\|4062875_4063199_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
AVO97020.1\|4063442_4063628_+	hypothetical protein	NA	NA	NA	NA
AVO97021.1\|4063648_4063876_-	DUF1272 domain-containing protein	NA	NA	NA	NA
AVO97022.1\|4063988_4065182_-	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
AVO97023.1\|4065804_4065990_+	stress-induced acidophilic repeat motif-containing protein	NA	NA	NA	NA
AVO97024.1\|4066080_4066575_+	ferritin-like domain-containing protein	NA	NA	NA	NA
AVO97025.1\|4066601_4067108_+	ferritin-like domain-containing protein	NA	NA	NA	NA
AVO97026.1\|4067124_4068000_+	Mn-containing catalase	NA	NA	NA	NA
AVO97027.1\|4068055_4069462_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
AVO97028.1\|4069458_4070469_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
AVO97029.1\|4070584_4070782_-	hypothetical protein	NA	NA	NA	NA
AVO97030.1\|4071348_4071981_+	DNA-binding protein	NA	NA	NA	NA
AVO97031.1\|4072589_4073276_+	diguanylate phosphodiesterase	NA	NA	NA	NA
AVO97032.1\|4073586_4075095_-	3,4-dihydroxybenzoate decarboxylase	NA	NA	NA	NA
AVO97033.1\|4075215_4076106_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVO97034.1\|4076112_4077897_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1
AVO97035.1\|4077969_4079178_-	HD domain-containing protein	NA	NA	NA	NA
AVO97036.1\|4080778_4080970_-	hypothetical protein	NA	NA	NA	NA
AVO97037.1\|4081185_4082100_+	lipid A biosynthesis palmitoleoyl acyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4
AVO97038.1\|4082189_4082828_+	leucine efflux protein	NA	NA	NA	NA
AVO97039.1\|4082958_4083222_+	DUF2534 domain-containing protein	NA	NA	NA	NA
AVO97040.1\|4083281_4083407_-	hypothetical protein	NA	NA	NA	NA
AVO98155.1\|4083524_4083599_-	hypothetical protein	NA	NA	NA	NA
AVO97041.1\|4083598_4083700_-	hypothetical protein	NA	NA	NA	NA
AVO97042.1\|4083757_4084771_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.9e-12	29.0
AVO97043.1\|4085071_4085311_+	DUF333 domain-containing protein	NA	NA	NA	NA
AVO97044.1\|4085300_4085657_-	DUF488 domain-containing protein	NA	NA	NA	NA
AVO97045.1\|4085643_4086153_-	DUF523 domain-containing protein	NA	NA	NA	NA
AVO97046.1\|4086298_4086991_+	hypothetical protein	NA	NA	NA	NA
AVO97047.1\|4087022_4088207_-	cyanate MFS transporter	NA	NA	NA	NA
AVO98156.1\|4088308_4089100_+	AraC family transcriptional regulator	NA	NA	NA	NA
AVO97048.1\|4089083_4089530_-	DUF441 domain-containing protein	NA	NA	NA	NA
AVO97049.1\|4089646_4090147_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
4097601:4097618	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4401126 : 4499402

111

Klebsiella_phage(60.78%)

portal,holin,transposase,tail,head,protease,capsid,integrase,terminase

attL 4395217:4395233|attR 4461831:4461847

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4395217:4395233	attL	NA	NA	NA	NA
AVO97340.1\|4401126_4402489_+\|transposase	IS3-like element ISKpn1 family transposase	A0A1B1P773	Bacillus_phage	3.0e-74	51.5
AVO97341.1\|4402708_4404109_+	class II fumarate hydratase	NA	NA	NA	NA
AVO97342.1\|4404098_4405031_-	DNA replication terminus site-binding protein	NA	NA	NA	NA
AVO97343.1\|4405106_4406408_-	two-component system sensor histidine kinase RstB	W8CYF6	Bacillus_phage	2.9e-18	24.0
AVO97344.1\|4406664_4407027_-	hypothetical protein	NA	NA	NA	NA
AVO97345.1\|4407269_4407989_-	two-component system response regulator RstA	NA	NA	NA	NA
AVO97346.1\|4408117_4408453_+	GlpM family protein	NA	NA	NA	NA
AVO97347.1\|4408449_4409172_-	dihydromonapterin reductase	NA	NA	NA	NA
AVO97348.1\|4409208_4410591_-	amino acid permease	NA	NA	NA	NA
AVO97349.1\|4410590_4410791_+	hypothetical protein	NA	NA	NA	NA
AVO97350.1\|4410768_4411719_-	DUF1471 domain-containing protein	NA	NA	NA	NA
AVO97351.1\|4411715_4411898_-	hypothetical protein	NA	NA	NA	NA
AVO97352.1\|4412240_4413770_+	Re/Si-specific NAD(P)(+) transhydrogenase subunit alpha	NA	NA	NA	NA
AVO97353.1\|4413780_4415169_+	Re/Si-specific NAD(P)(+) transhydrogenase subunit beta	NA	NA	NA	NA
AVO98163.1\|4415317_4415506_+	hypothetical protein	NA	NA	NA	NA
AVO97354.1\|4415615_4416566_-	universal stress protein UspE	NA	NA	NA	NA
AVO97355.1\|4416704_4417457_-	transcriptional regulator FNR	NA	NA	NA	NA
AVO97356.1\|4417651_4418167_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	4.6e-23	53.5
AVO97357.1\|4418459_4418618_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
AVO97358.1\|4419228_4419489_-	pyocin activator protein PrtN	A0A1L5C290	Pseudoalteromonas_phage	1.5e-11	43.7
AVO97359.1\|4420002_4420227_-	hypothetical protein	A0A286S2B3	Klebsiella_phage	2.0e-28	89.2
AVO97360.1\|4420223_4420787_-	hypothetical protein	A0A088C4R7	Shewanella_sp._phage	3.7e-26	37.2
AVO97361.1\|4420783_4421500_-	DNA-binding protein	A0A286S260	Klebsiella_phage	5.1e-105	83.9
AVO97362.1\|4421505_4422024_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	1.1e-93	98.3
AVO97363.1\|4422128_4422956_-\|protease	serine protease	Q8W654	Enterobacteria_phage	5.5e-111	84.0
AVO97364.1\|4422952_4423147_-	hypothetical protein	NA	NA	NA	NA
AVO97365.1\|4423143_4423569_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	3.5e-53	77.9
AVO97366.1\|4424001_4424367_-	hypothetical protein	A0A286S1Q6	Klebsiella_phage	5.8e-57	97.5
AVO97367.1\|4424367_4424592_-	hypothetical protein	NA	NA	NA	NA
AVO97368.1\|4424763_4424958_-	hypothetical protein	A0A286S1P8	Klebsiella_phage	2.6e-08	50.0
AVO97369.1\|4424947_4425256_-	hypothetical protein	A0A286S1T9	Klebsiella_phage	3.5e-23	59.6
AVO97370.1\|4425414_4426122_-	hypothetical protein	G8C7U1	Escherichia_phage	4.0e-54	50.6
AVO97371.1\|4426246_4426474_+	transcriptional regulator	A0A0N7C1T6	Escherichia_phage	9.0e-16	60.0
AVO97372.1\|4426549_4426738_+	DUF4222 domain-containing protein	NA	NA	NA	NA
AVO97373.1\|4426734_4427565_+	helix-turn-helix domain-containing protein	A5LH71	Enterobacteria_phage	1.8e-85	67.9
AVO97374.1\|4427576_4428455_+	AAA family ATPase	Q8W641	Enterobacteria_phage	1.9e-82	62.7
AVO97375.1\|4428451_4429831_+	helicase	Q8W640	Enterobacteria_phage	1.6e-160	65.0
AVO97376.1\|4429817_4430186_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	2.1e-38	60.3
AVO97377.1\|4430182_4430965_+	antitermination protein	F1C595	Cronobacter_phage	8.5e-114	78.3
AVO97378.1\|4431241_4431553_+\|holin	holin	A0A286N2Q5	Klebsiella_phage	1.1e-40	83.5
AVO97379.1\|4431549_4432089_+	hypothetical protein	A0A286N2Q6	Klebsiella_phage	5.7e-101	98.3
AVO97380.1\|4432085_4432433_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	1.2e-40	81.7
AVO97381.1\|4432429_4432705_+	hypothetical protein	G8C7W1	Escherichia_phage	4.4e-09	42.7
AVO97382.1\|4432655_4432850_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	6.9e-25	85.9
AVO97383.1\|4432846_4433140_+	hypothetical protein	G8C7W3	Escherichia_phage	1.3e-30	71.1
AVO97384.1\|4433244_4433490_+	DUF2560 domain-containing protein	A0A286N2R1	Klebsiella_phage	5.9e-13	51.3
AVO97385.1\|4433651_4433966_+	hypothetical protein	NA	NA	NA	NA
AVO97386.1\|4433974_4434265_+	HNH endonuclease	A0A286N2R3	Klebsiella_phage	2.5e-50	91.7
AVO97387.1\|4434477_4434912_+	hypothetical protein	A0A286S1P9	Klebsiella_phage	6.2e-74	100.0
AVO97388.1\|4434921_4436454_+\|terminase	terminase	A0A286S1M9	Klebsiella_phage	3.9e-296	100.0
AVO97389.1\|4436456_4437734_+\|portal	phage portal protein	A0A286S1N5	Klebsiella_phage	1.8e-246	99.5
AVO97390.1\|4437739_4438420_+\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.6e-124	100.0
AVO97391.1\|4438431_4439595_+\|capsid	phage major capsid protein	A0A286S1R4	Klebsiella_phage	2.7e-212	100.0
AVO97392.1\|4439821_4440148_+\|head,tail	phage gp6-like head-tail connector protein	A0A286S294	Klebsiella_phage	7.5e-56	100.0
AVO97393.1\|4440208_4440406_+	hypothetical protein	A0A286S2A5	Klebsiella_phage	1.7e-26	100.0
AVO97394.1\|4440407_4440740_+\|head,tail	head-tail adaptor protein	A0A286S2A2	Klebsiella_phage	3.1e-57	100.0
AVO97395.1\|4440732_4441272_+	hypothetical protein	A0A286S249	Klebsiella_phage	1.0e-94	100.0
AVO97396.1\|4441268_4441634_+	DUF3168 domain-containing protein	A0A286S1R1	Klebsiella_phage	3.9e-61	92.6
AVO97397.1\|4441690_4442182_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	2.3e-88	100.0
AVO97398.1\|4442225_4442579_+\|tail	phage tail protein	A0A286S1N4	Klebsiella_phage	1.3e-48	80.3
AVO97399.1\|4442611_4442875_+\|tail	phage tail protein	A0A286S1P2	Klebsiella_phage	6.9e-44	98.9
AVO97400.1\|4443400_4445836_+\|tail	phage tail tape measure protein	A0A286S1S3	Klebsiella_phage	0.0e+00	88.5
AVO97401.1\|4445835_4446315_+	hypothetical protein	A0A286S298	Klebsiella_phage	1.7e-93	98.7
AVO97402.1\|4446301_4446784_+	DUF1833 domain-containing protein	A0A286S2B1	Klebsiella_phage	4.3e-84	97.5
AVO97403.1\|4446793_4447174_+	nitrite transporter	A0A286S2A6	Klebsiella_phage	4.6e-73	100.0
AVO97404.1\|4447170_4450239_+	kinase	A0A286S259	Klebsiella_phage	0.0e+00	97.8
AVO97405.1\|4450316_4453106_+	hypothetical protein	NA	NA	NA	NA
AVO97406.1\|4453347_4454468_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	3.9e-51	42.4
AVO97407.1\|4454791_4455325_+	hypothetical protein	NA	NA	NA	NA
AVO97408.1\|4455363_4455594_+	hypothetical protein	NA	NA	NA	NA
AVO97409.1\|4456272_4456689_+	hypothetical protein	K7P834	Enterobacteria_phage	6.1e-26	46.1
AVO97410.1\|4456874_4457975_-\|integrase	integrase	A0A1W6JP34	Morganella_phage	2.2e-115	56.8
AVO97411.1\|4458103_4459222_-	aminobenzoyl-glutamate transporter	NA	NA	NA	NA
AVO97412.1\|4459345_4460791_-	amidohydrolase	NA	NA	NA	NA
AVO97413.1\|4460790_4462101_-	amidohydrolase	NA	NA	NA	NA
4461831:4461847	attR	NA	NA	NA	NA
AVO97414.1\|4462267_4463176_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVO97415.1\|4463277_4463841_+	DNA endonuclease SmrA	NA	NA	NA	NA
AVO97416.1\|4463837_4464644_-	IclR family transcriptional regulator	NA	NA	NA	NA
AVO97417.1\|4464813_4465500_+	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
AVO97418.1\|4465510_4466167_+	CoA transferase subunit B	NA	NA	NA	NA
AVO97419.1\|4466176_4467379_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
AVO97420.1\|4467388_4468741_+	3-carboxy-cis,cis-muconate cycloisomerase	NA	NA	NA	NA
AVO97421.1\|4468730_4469495_+	3-oxoadipate enol-lactonase	NA	NA	NA	NA
AVO97422.1\|4469487_4469877_+	4-carboxymuconolactone decarboxylase	NA	NA	NA	NA
AVO97423.1\|4470481_4472089_-	mechanosensitive ion channel protein MscS	NA	NA	NA	NA
AVO97424.1\|4472260_4473913_-	fumarate hydratase	NA	NA	NA	NA
AVO97425.1\|4473967_4475479_-	anion permease	NA	NA	NA	NA
AVO97426.1\|4475903_4476035_+	transcriptional regulator	NA	NA	NA	NA
AVO97427.1\|4476121_4478899_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	1.1e-65	31.1
AVO97428.1\|4478966_4479917_+	FAD:protein FMN transferase	NA	NA	NA	NA
AVO97429.1\|4479897_4480617_-	two-component system response regulator DcuR	NA	NA	NA	NA
AVO97430.1\|4480613_4482230_-	two-component system sensor histidine kinase DcuS	NA	NA	NA	NA
AVO97431.1\|4482385_4482742_+	hypothetical protein	NA	NA	NA	NA
AVO97432.1\|4482905_4483826_+	N-acetylmuramic acid 6-phosphate etherase	NA	NA	NA	NA
AVO97433.1\|4484090_4485746_+	malate dehydrogenase (quinone)	NA	NA	NA	NA
AVO97434.1\|4485906_4486302_-	hypothetical protein	NA	NA	NA	NA
AVO98164.1\|4486304_4487483_-	hypothetical protein	NA	NA	NA	NA
AVO97435.1\|4487670_4487874_-	hypothetical protein	NA	NA	NA	NA
AVO97436.1\|4488136_4489063_+	LysR family transcriptional regulator	NA	NA	NA	NA
AVO97437.1\|4489052_4489955_-	malonate decarboxylase subunit epsilon	NA	NA	NA	NA
AVO97438.1\|4490574_4491534_-	AEC family transporter	A0A0U2C0Y4	Salmonella_phage	2.7e-53	90.3
AVO97439.1\|4491670_4492471_-	biotin-independent malonate decarboxylase subunit gamma	NA	NA	NA	NA
AVO97440.1\|4492470_4493304_-	biotin-independent malonate decarboxylase subunit beta	NA	NA	NA	NA
AVO97441.1\|4493296_4493596_-	malonate decarboxylase acyl carrier protein	NA	NA	NA	NA
AVO97442.1\|4493613_4494456_-	triphosphoribosyl-dephospho-CoA synthase	NA	NA	NA	NA
AVO97443.1\|4494455_4496111_-	malonate decarboxylase subunit alpha	NA	NA	NA	NA
AVO97444.1\|4496335_4497370_-	AI-2E family transporter	NA	NA	NA	NA
AVO97445.1\|4497812_4498175_+	multidrug transporter subunit MdtJ	NA	NA	NA	NA
AVO97446.1\|4498161_4498491_+	spermidine export protein MdtI	NA	NA	NA	NA
AVO97447.1\|4498534_4498651_-	ArsR family transcriptional regulator	NA	NA	NA	NA
AVO98165.1\|4498664_4499402_-\|protease	serine protease	NA	NA	NA	NA

DBSCAN-SWA_7

4534693 : 4545580

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AVO97480.1\|4534693_4535314_-	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
AVO97481.1\|4535306_4536572_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	3.9e-233	99.5
AVO97482.1\|4536583_4537486_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
AVO97483.1\|4537746_4538508_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
AVO97484.1\|4538528_4539389_-	class A broad-spectrum beta-lactamase SHV-11	A0A077SL40	Escherichia_phage	2.2e-155	99.3
AVO97485.1\|4539686_4539947_+	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
AVO97486.1\|4540033_4541122_+	chromosome segregation protein SMC	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
AVO97487.1\|4541152_4542418_-	MFS transporter	NA	NA	NA	NA
AVO97488.1\|4542472_4545580_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage