CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
CP026211	Citrobacter sp. CFNIH10 plasmid pCIT-eb1a, complete sequence	0 crisprs	RT,csa3	0	1
CP026216	Citrobacter sp. CFNIH10 chromosome, complete genome	1 crisprs	WYL,DEDDh,cas3,RT,csa3,DinG	1	14
CP026214	Citrobacter sp. CFNIH10 plasmid pCIT-dfda, complete sequence	0 crisprs	NA	0	0
CP026215	Citrobacter sp. CFNIH10 plasmid pCIT-ce4a, complete sequence	0 crisprs	NA	0	0
CP026213	Citrobacter sp. CFNIH10 plasmid pKPC-933d, complete sequence	0 crisprs	csa3,RT	0	2
CP026210	Citrobacter sp. CFNIH10 plasmid pKPC-2fe2, complete sequence	0 crisprs	DEDDh	0	1
CP026212	Citrobacter sp. CFNIH10 plasmid pCIT-a850, complete sequence	0 crisprs	csa3,RT	0	4

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28088 : 48205

Escherichia_phage(37.5%)

transposase,protease,integrase

attL 34084:34143|attR 35393:35534

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62425.1\|28088_28742_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AUZ62465.1\|28821_29205_+	DUF1496 domain-containing protein	NA	NA	NA	NA
AUZ62426.1\|29309_29705_+	lytic transglycosylase	NA	NA	NA	NA
AUZ62466.1\|29749_31012_+	conjugal transfer protein TrbA	NA	NA	NA	NA
AUZ62427.1\|31022_31973_+	DsbC family protein	NA	NA	NA	NA
AUZ62428.1\|31985_34073_+	conjugal transfer protein TrbC	NA	NA	NA	NA
34084:34143	attL	NA	NA	NA	NA
AUZ62429.1\|34256_34604_-\|integrase	class 1 integron integrase IntI1	NA	NA	NA	NA
AUZ62467.1\|34752_35286_+	aminoglycoside nucleotidyltransferase ANT(2'')-Ia	NA	NA	NA	NA
AUZ62430.1\|35681_36542_-	class A broad-spectrum beta-lactamase TEM-1	Q1MVP3	Enterobacteria_phage	4.6e-161	100.0
35393:35534	attR	NA	NA	NA	NA
AUZ62431.1\|37241_38066_-	oxacillin-hydrolyzing class D beta-lactamase OXA-9	NA	NA	NA	NA
AUZ62432.1\|38125_38914_-	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1	NA	NA	NA	NA
AUZ62468.1\|38983_39538_-	aminoglycoside N-acetyltransferase AAC(6')-Ib'	NA	NA	NA	NA
AUZ62433.1\|39771_40329_-	recombinase	Q1MVP4	Enterobacteria_phage	2.0e-93	98.4
AUZ62434.1\|40686_41391_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ62435.1\|42367_42973_+	DNA resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	5.5e-20	35.3
AUZ62436.1\|43286_44606_+\|transposase	IS1182 family transposase ISKpn6	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2
AUZ62437.1\|44855_45737_-	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
AUZ62438.1\|46261_46966_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ62439.1\|47330_47510_-	hypothetical protein	NA	NA	NA	NA
AUZ62440.1\|47500_48205_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. CP026216

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP026216_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP026216_2

3657741-3657864

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP026216_2

>merge|CP026216|2|3657741-3657864|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACGGACGCAAAATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>CP026216|2|2|3657741-3657864|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CGGACGCAAAATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
CP026216.1\|AUZ66186.1\|3654218_3654359_-\|hypothetical-protein	unknown	unknown	unknown
CP026216.1\|AUZ66190.1\|3659615_3660257_+\|riboflavin-synthase	unknown	unknown	gnl\|CDD\|183846
CP026216.1\|AUZ66198.1\|3667482_3668316_-\|peptidoglycan-endopeptidase	unknown	unknown	gnl\|CDD\|223862
CP026216.1\|AUZ66189.1\|3657053_3657359_-\|monooxygenase	unknown	unknown	gnl\|CDD\|182975
CP026216.1\|AUZ66184.1\|3652842_3653676_-\|cysteine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270407
CP026216.1\|AUZ66183.1\|3652022_3652841_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
CP026216.1\|AUZ66187.1\|3654442_3656053_-\|FAD/NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|182134
CP026216.1\|AUZ66194.1\|3663985_3665011_-\|HTH-type-transcriptional-repressor-PurR	unknown	unknown	gnl\|CDD\|236739
CP026216.1\|AUZ66185.1\|3653908_3654100_+\|hypothetical-protein	unknown	unknown	unknown
CP026216.1\|AUZ66191.1\|3660298_3661447_-\|cyclopropane-fatty-acyl-phospholipid-synthase	unknown	unknown	gnl\|CDD\|183282
CP026216.1\|AUZ66196.1\|3665561_3666728_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
CP026216.1\|AUZ67822.1\|3658022_3659396_-\|multidrug-transporter-MdtK	unknown	unknown	gnl\|CDD\|234981
CP026216.1\|AUZ66195.1\|3665304_3665394_+\|YnhF-family-membrane-protein	unknown	unknown	unknown
CP026216.1\|AUZ66188.1\|3656219_3657017_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293813
CP026216.1\|AUZ66193.1\|3663056_3663989_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182948
CP026216.1\|AUZ66181.1\|3650576_3651254_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP026216.1\|AUZ66192.1\|3661739_3662945_-\|Bcr/CflA-family-multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|182924
CP026216.1\|AUZ66182.1\|3651243_3652023_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
CP026216.1\|AUZ66197.1\|3666774_3667356_-\|superoxide-dismutase-[Fe]	unknown	unknown	gnl\|CDD\|182534
CP026216.1\|AUZ66180.1\|3649762_3650572_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182159

Protein	Function_ID	Function_description	E-value
CP026216.1\|AUZ66190.1\|3659615_3660257_+\|riboflavin-synthase	gnl\|CDD\|183846	PRK13020, PRK13020, riboflavin synthase subunit alpha; Provisional.	2.67238e-122
CP026216.1\|AUZ66198.1\|3667482_3668316_-\|peptidoglycan-endopeptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	6.77572e-45
CP026216.1\|AUZ66189.1\|3657053_3657359_-\|monooxygenase	gnl\|CDD\|182975	PRK11118, PRK11118, putative monooxygenase; Provisional.	2.32202e-63
CP026216.1\|AUZ66184.1\|3652842_3653676_-\|cysteine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270407	cd13689, PBP2_BsGlnH, Substrate binding domain of ABC glutamine transporter from Bacillus subtilis; the type 2 periplasmic-bindig protein fold. This group includes periplasmic glutamine-binding domain GlnP from Bacillus subtilis and its related proteins. The GlnP domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.39857e-107
CP026216.1\|AUZ66183.1\|3652022_3652841_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.36443e-141
CP026216.1\|AUZ66187.1\|3654442_3656053_-\|FAD/NAD(P)-binding-domain-containing-protein	gnl\|CDD\|182134	PRK09897, PRK09897, FAD-NAD(P)-binding protein.	0
CP026216.1\|AUZ66194.1\|3663985_3665011_-\|HTH-type-transcriptional-repressor-PurR	gnl\|CDD\|236739	PRK10703, PRK10703, HTH-type transcriptional repressor PurR.	0
CP026216.1\|AUZ66191.1\|3660298_3661447_-\|cyclopropane-fatty-acyl-phospholipid-synthase	gnl\|CDD\|183282	PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase.	0
CP026216.1\|AUZ67822.1\|3658022_3659396_-\|multidrug-transporter-MdtK	gnl\|CDD\|234981	PRK01766, PRK01766, multidrug efflux protein; Reviewed.	0
CP026216.1\|AUZ66196.1\|3665561_3666728_+\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	4.98579e-100
CP026216.1\|AUZ66188.1\|3656219_3657017_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293813	cd07727, YmaE-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis YmaE and related proteins; MBL-fold metallo hydrolase domain. Includes the uncharacterized Bacillus subtilis YmaE and Nostoc all1228 proteins.Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry. .	2.68208e-44
CP026216.1\|AUZ66193.1\|3663056_3663989_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182948	PRK11074, PRK11074, putative DNA-binding transcriptional regulator; Provisional.	0
CP026216.1\|AUZ66181.1\|3650576_3651254_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.23181e-42
CP026216.1\|AUZ66192.1\|3661739_3662945_-\|Bcr/CflA-family-multidrug-efflux-MFS-transporter	gnl\|CDD\|182924	PRK11043, PRK11043, Bcr/CflA family multidrug efflux MFS transporter.	0
CP026216.1\|AUZ66182.1\|3651243_3652023_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	4.34882e-53
CP026216.1\|AUZ66197.1\|3666774_3667356_-\|superoxide-dismutase-[Fe]	gnl\|CDD\|182534	PRK10543, PRK10543, superoxide dismutase [Fe].	2.26163e-137
CP026216.1\|AUZ66180.1\|3649762_3650572_+\|hypothetical-protein	gnl\|CDD\|182159	PRK09946, PRK09946, hypothetical protein; Provisional.	8.01417e-154

>CP026216.1|AUZ66189.1|3657053_3657359_-|monooxygenase
MPKLLQLHFAFTGPFGAEMAEQLRGLAESINQEPGFIWKVWTESEQNKEAGGIYLFESEETALAYLDKHTARLKNLGVDEVIAKVFDVNIPLSEINNARVG
>CP026216.1|AUZ66188.1|3656219_3657017_+|MBL-fold-metallo-hydrolase
MITLCKACGTSYDNHHGNVKRCKICDDERQYIPVSGQAWMDFDELIASHTNKWQQHTPQLFSLKTVPSFAINQRAFLLRTPVGNILWDCVANLDPATRTLIRAMGGLSAIAISHPHYYTTMQDWAEAFDAPVWLHAADRDWIMRDSPWIRLWEGEEHNVLPGVSLLRLGGHFAGGTVLYLEEGEGTILAGDILQVTPGADAVSFMWSYPNMLPLSSKTVGGIIQRLNTVTFSSLYGAFEGQNITHNASQIVQRSGEKYLSSLASR
>CP026216.1|AUZ66187.1|3654442_3656053_-|FAD/NAD(P)-binding-domain-containing-protein
MKKIAIIGAGPTGVYTFFSLLKEEQPLEIVVFERGNRAGIGMPYTHSDNSPMMLANIASIEVPPLFDTWLEWLQTQEAQYLAQFAVKKETLHQRQFLPRILLGDYFRAQFLQAVHHAENRGFKVRLYESCEVTDVSAVSTGVQLWTDQHTEPLHVDLAVIATGHVWPDDDESTHAFYPSPWSGLMDADVPAARVGILGTSLSALDAAMAVAVQHGTFHETEEHQVNFTLNKGSEALEITLMSRSGILPEADFYCPIPYEPLEYVTDEAIQREIAAGSTELLDRVFRLMQQELALADPKWARQMSLSSLDADSFPVAVFADRARSDPFEWAAANLKEVDENKRNKHTVAWRYTLLRLHEKVQEIVTHLNEQDSERFNVGLARVFIDNYAAIPSESVRRMLALHAAGILRILTLGQDYRKEIKADRTEITTHNDRLSFDVFIDARGQKPLKTKDLPFPRLRQQLLSCGDAIPDVGDDYTLQAPENVRGRIAFGALPYLMHDRPFIQGLVACQEIGNAMARAVSKPASRLRRRLSIYDR
>CP026216.1|AUZ66186.1|3654218_3654359_-|hypothetical-protein
MEIDLDNLVFNGLEEAQERNAERLDDADKKAESVIADDDCGDACKI
>CP026216.1|AUZ66185.1|3653908_3654100_+|hypothetical-protein
MEKVNMQMARRWMRVAITPKRTRQPGAEVNLQRVVESILPVASLYGVDIANIDPEWFRDQTTR
>CP026216.1|AUZ66184.1|3652842_3653676_-|cysteine-ABC-transporter-substrate-binding-protein
MMATKTQRTKKTILALGVMLATSFLSIQAQADQLADIKAAGVVKVATFDANPPFGSVDAKTHQIVGYDVDFAQALAASLGVKLELVATNPANRIPLLQSGKADLIVADITITPERAQVIDFSVPYFVTGQQFLVPASSPDKLDEYSRARIGAVKGTTGEQALHQRFPQSRVLAYDDIPLALTALRNGNVQAITQDSTILAGLLSGAPDKAQFKILPDLLSKEEIGVGVKKGEPALLKAVNDELLRLESSGQAGKIYDVWFGPETKNPQPRAFKIEAR
>CP026216.1|AUZ66183.1|3652022_3652841_-|amino-acid-ABC-transporter-ATP-binding-protein
MLAGLFTPSAAGAADFHTLRQARVELRDVVKAYGDHRVLNGVSLTVEPGEVVTILGPSGSGKSTLIRLINQLESLSGGDIFIDDKPVGQLKGAALRQLRSRIGFVFQQFNLYAHLTAQQNITLALEYVHGWNKTDATQRAYALLEQVGLEEKAGAYPAQLSGGQQQRVAIARALASSPQILLFDEPTSALDPEMIGEVLQVMKRLAHSGITMIVVTHEMHFAREIADRVVFIDGGDILEIASPEAFFTRPQHPRTQRFLQKVLDPLHQELSR
>CP026216.1|AUZ66182.1|3651243_3652023_-|amino-acid-ABC-transporter-permease
MPSMDWQGVLTGLPLQWILSGFLTTLWVSAAGIFLATLLAILLLALRLSGHRMGRRLVAGWVSLFRNTPLLVQLLFWYFAGWNLLPRSFITFVNAEHGWSILPGNVWWLTPEFLCSAWGLGVFTSAFLVEEVASGLQAVSAGQREAAISQGFSSWQTFRHILLPQGLTNAWQPVVGQYLNLMKLSSLASGIGFAELTYQVRQIESYNAHALEAFAVGTALYLFAGVAFGLLLTHLGPAPRLEKKPQLRRFRFRSPQHDR
>CP026216.1|AUZ66181.1|3650576_3651254_-|amino-acid-ABC-transporter-permease
MIANIAVITDNLDYLLWGRLADGQPGGVLLTLMMALGAAVLALPAGIALAALAWRFPGVIRKGLFIWAELIRGIPLIFVIFWMWYLLPMLTGSDLPGAATVTLALAWFTAASVMHSVYAGLNALPAGQYDAAVAQGFSPVQALRRVLLPQVLRHILPSLTGICIGLLKDTSLAFIVNVPELTTVAGQVNSREQIYPAAIFIFTGLVYYLLCYGLEKATRRRFALR
>CP026216.1|AUZ66180.1|3649762_3650572_+|hypothetical-protein
MLITREDIRNWRVGAVMYRWFLRRFPEGGNYADVHRALSREGYLDWANSLVEYAWSRWLDEENFARQDISAMSRLARPDISMGDQQVANADDNANLGCAGDNMKIASAGYASQIASAGYCVRIGSVGYNSHISSSGDRARLAAAGNSTRISSAGNGTRIASSGMRVRVSSLGERNHVASNGDLSQIVSFGANAKIANSGDNVHIICNGDNAIVASTGVVDSVVLGPGGCAALAYHDGKRMRFAVAVEGEAGIRAGVKYRLDDAHQFVEC
>CP026216.1|AUZ67822.1|3658022_3659396_-|multidrug-transporter-MdtK
MQKYISEARQLLALAIPVILAQIAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILFGHGLLLALTPVIAQLNGSGRRDRIAHQVRQGFWLAGFVSLLIMIVLWNAGYIIRSMHNIDPALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFLGLLVNIPVNYIFIYGHFGMPELGGVGCGVATAAVYWVMFSAMLWYVKHARSMRDIRNEQRFSKPDNVVMKRLVQLGLPIALALFFEVTLFAVVALLVSPLGIVDVAGHQIALNFSSLMFVLPMSLAAAVTIRVGYRLGQGSTLDAQTAARTGLGVGVCMACLTAIFTVTLREHIALLYNDNPEVVTLAAQLMLLAAVYQISDSIQVIGSGILRGYKDTRSIFFITFTAYWVLGLPSGYILALTDLVVDRMGPAGFWMGFIIGLTSAAVMMMLRMRFLQRLPSTVILQRAAR
>CP026216.1|AUZ66190.1|3659615_3660257_+|riboflavin-synthase
MFTGIVQGTAKLVSIDEKPNFRTHVVELPEYMLDALETGASVAHNGCCLTVTEINGNRISFDLMKETLRITNLGDLKVGDLLNVERAAKFSDEIGGHLMSGHIMTTAEVSKILTSENNRQIWFKVQDPTLMKYILYKGFIGIDGISLTVGEVTATRFCVHLIPETLERTTLGKKKLGARVNIEIDPQTQAVVDTVERVLAAREAAVTKTASEA
>CP026216.1|AUZ66191.1|3660298_3661447_-|cyclopropane-fatty-acyl-phospholipid-synthase
MSSSCIEEVSVPDDDWYRITNELLSRAGIAINGSSPADIRVKNPDFFKRVLQEGSLGLGESYMDGWWECDRLDQFFSKVLRAGLENQLPHHFKDTLRIAAARLFNLQSKKRAWIVGKEHYDLGNDLFSRMLDPFMQYSCAYWKDADTLEAAQQAKLRLICEKLQLQPGMRVLDIGCGWGGLSHYMATHYGVSVVGVTISAEQQKMAQARCAGLDVSILLQDYRDLHDQFDRIVSVGMFEHVGPKNYATYFDVVDRNLKPEGLFLLHTIGSKKTDNNVDPWINKYIFPNGCLPSVRQIANASESHFVMEDWHNFGADYDKTLMAWYERFLAAWPEIAENYSERFKRMFSYYLNACAGAFRARDIQLWQVVFSRGVEDGLRVAR
>CP026216.1|AUZ66192.1|3661739_3662945_-|Bcr/CflA-family-multidrug-efflux-MFS-transporter
MQPGKGFLVWLAGLSVLGFLATDMYLPAFAAIQSDLQTPASAVSASLSLFLAGFAVAQLLWGPLSDRYGRKPILLLGLSVFALGSLGMLWVESATGLLVLRFIQAVGVCAATVIWQALVTDYYPSHKINRIFATIMPLVGLSPALAPLLGSWILTHLSWQAIFATLFFITLLLMLPALFLKPTTRARDDSKDKLTFTTLLRAKAYRGNVLIYAACSASFFAWLTGSPFILSEMGYSPAVIGLSYVPQTIAFLIGGYGCRAALQKWQGQQLLPWLLVIYALSVVATWAASFIHHITLAEILIPFCIMAIANGAIYPIVVAQALRPFPQATGRAAALQNTLQLGLCFLASLVVSWLISTPLLTTTSVMLSTVVLAGLGYKMQLHPSNDCAQHDNCGIAHSESH
>CP026216.1|AUZ66193.1|3663056_3663989_+|LysR-family-transcriptional-regulator
MWSEYALEVVDAVARNGSFSSAAQELHRVPSAVSYTVRQLEEWLAVPLFERRHRDVVLTPAGAWFLKEGRSVIKKMQITRQQCQQIANGWRGQLPIAVDNIVRPERTRQLIVDFYRHFDDVELLVFQEVFNGVWDALSDGRVELAIGATQAIPVGGRYTFRDMGKLSWCCVVASTHPLAAMSGPLSDDTLRNWPSLVLEDTSRTLPKRVTWLLDNQKRVVVPDWDSSATCISAGLCVGMVPTHFAKPYLNKGQWVALNLENPFPDAACCLTWQQNDMSPALIWLLDYLGDSETLNKEWLREPDETPAEEA
>CP026216.1|AUZ66194.1|3663985_3665011_-|HTH-type-transcriptional-repressor-PurR
MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIEAVEKNCFQKGYTLILGNVWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPDPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFEGGYMAGRYLVERGHREIGVIPGLMERNTGAGRLAGFMKAMDEALIKVPENWIVQGDFEPESGYRAMQQILSQAHRPTAVFCGGDVMAMGALCAADEMGLRVPQDVSLIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR
>CP026216.1|AUZ66195.1|3665304_3665394_+|YnhF-family-membrane-protein
MSTDLKFSLVTTFIVLALIVAGGLTAALH
>CP026216.1|AUZ66196.1|3665561_3666728_+|MFS-transporter
MKINYPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAVGVMVGAPLMTLLLSHRGRRNALIFLMAIFTLGNVLSAISPDYTTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAVATMFMGLTIANIGGVPAATWLGETIGWRMSFMATAGLGVISMLSLFLSLPKGGAGARPEVKKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLQSITHATPAFVTGMLVLIGVGFSIGNYLGGKLADRSVNGTLKGFLLLLMVIMLAIPFLAQNELGAAVSMVVWGAATFAVVPPLQMRVMRVAHEAPGLSSSVNIGAFNLGNALGAAAGGAVISGGLGYSFVPVMGAIVAGMALLLVFISARKQPEQVCVAS
>CP026216.1|AUZ66197.1|3666774_3667356_-|superoxide-dismutase-[Fe]
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIVRSSEGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGELADAIAASFGSFAEFKAQFTDAAIKNFGSGWTWLVKGKEGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLEHFWALVNWEFVAKNFAA
>CP026216.1|AUZ66198.1|3667482_3668316_-|peptidoglycan-endopeptidase
MARINRLSLTLCALLFTTIPFMPMAHASKQARDTAGLTDSKKTSNKKKSTATAKKTNKTNQKTARKTTSKTSTKTASSSKKKITASAKTSKTASRKSKTVAAKKTAAVSWSEKCTPRKGHKPTCVKVKNTASGKIADAHKVKVQKATSTAMNKLMSQIGKPYRWGGTSPRTGFDCSGLVYYAYKDLVKFRIPRTANEMYHLRDAAPIDRGELKNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRSGQEIQITSLSEDYWQRHYVGARRVMTPKTIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
CP026216_2	2.1\|3657784\|38\|CP026216\|CRISPRCasFinder	3657784-3657821	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	2	0.947

1. spacer 2.1|3657784|38|CP026216|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 2, identity: 0.947

cggacgcaaaatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
*.******.*****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

389333 : 457332

Vibrio_phage(40.0%)

plate,tRNA,protease,integrase

attL 409776:409794|attR 438101:438119

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ63277.1\|389333_389834_+\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
AUZ63278.1\|389925_390633_+	deoxyribonuclease I	NA	NA	NA	NA
AUZ63279.1\|390712_391444_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
AUZ63280.1\|391456_392404_+	glutathione synthase	NA	NA	NA	NA
AUZ63281.1\|392578_393142_+	YqgE/AlgH family protein	NA	NA	NA	NA
AUZ63282.1\|393141_393558_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
AUZ63283.1\|393571_394552_-	type IV pili twitching motility protein PilT	NA	NA	NA	NA
AUZ63284.1\|394569_395274_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
AUZ63285.1\|395292_395859_+	YggT family protein	NA	NA	NA	NA
AUZ63286.1\|395855_396146_+	YggU family protein	NA	NA	NA	NA
AUZ63287.1\|396153_396747_+	XTP/dITP diphosphatase	NA	NA	NA	NA
AUZ63288.1\|396739_397876_+	YggW family oxidoreductase	NA	NA	NA	NA
AUZ63289.1\|397907_398915_-	DUF1202 domain-containing protein	NA	NA	NA	NA
AUZ63290.1\|399048_400095_-	L-asparaginase 2	NA	NA	NA	NA
AUZ63291.1\|400284_401004_-	DUF2884 domain-containing protein	NA	NA	NA	NA
AUZ63292.1\|401056_401383_-	DUF469 domain-containing protein	NA	NA	NA	NA
AUZ63293.1\|401382_402102_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
AUZ63294.1\|402164_402311_+	adenine glycosylase	NA	NA	NA	NA
AUZ63295.1\|402264_403317_+	adenine DNA glycosylase	NA	NA	NA	NA
AUZ63296.1\|403344_403620_+	Fe(2+)-trafficking protein	NA	NA	NA	NA
AUZ63297.1\|403693_404776_+	membrane-bound lytic murein transglycosylase MltC	NA	NA	NA	NA
AUZ63298.1\|404988_406245_+	nucleoside permease	NA	NA	NA	NA
AUZ63299.1\|406340_408476_-	ornithine decarboxylase	NA	NA	NA	NA
AUZ63300.1\|408903_409611_+	DUF554 domain-containing protein	NA	NA	NA	NA
409776:409794	attL	NA	NA	NA	NA
AUZ63301.1\|409974_411246_+	DUF4102 domain-containing protein	Q7M297	Enterobacteria_phage	5.3e-73	36.3
AUZ63302.1\|411254_411578_+	hypothetical protein	NA	NA	NA	NA
AUZ63303.1\|411618_413097_-	relaxase	NA	NA	NA	NA
AUZ63304.1\|413093_413465_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AUZ63305.1\|413451_413712_-	hypothetical protein	NA	NA	NA	NA
AUZ63306.1\|414257_414962_+	hypothetical protein	NA	NA	NA	NA
AUZ63307.1\|415101_415281_-	hypothetical protein	NA	NA	NA	NA
AUZ63308.1\|415911_416115_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	8.0e-08	42.6
AUZ63309.1\|416645_417905_+\|integrase	integrase	B7SYF8	Stenotrophomonas_phage	1.9e-83	43.6
AUZ63310.1\|418078_418984_-	DNA-binding protein	NA	NA	NA	NA
AUZ63311.1\|419362_419596_-	hypothetical protein	NA	NA	NA	NA
AUZ63312.1\|419623_419809_-	hypothetical protein	NA	NA	NA	NA
AUZ63313.1\|419843_420065_-	DNA-binding protein	A0A2I7S995	Vibrio_phage	6.1e-17	62.7
AUZ63314.1\|420061_420523_-	hypothetical protein	NA	NA	NA	NA
AUZ63315.1\|420964_422935_+	ATP-dependent endonuclease	NA	NA	NA	NA
AUZ63316.1\|423089_423707_+	hypothetical protein	NA	NA	NA	NA
AUZ63317.1\|423706_424774_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
AUZ63318.1\|424957_427285_+	ATPase	NA	NA	NA	NA
AUZ63319.1\|427288_428605_+	ATP-binding protein	NA	NA	NA	NA
AUZ63320.1\|428601_430800_+	DEAD/DEAH box helicase	NA	NA	NA	NA
AUZ63321.1\|430811_435506_+	hypothetical protein	NA	NA	NA	NA
AUZ67670.1\|437404_437734_+	hypothetical protein	NA	NA	NA	NA
AUZ63322.1\|438565_438901_-	hypothetical protein	NA	NA	NA	NA
438101:438119	attR	NA	NA	NA	NA
AUZ63323.1\|438903_439767_-	flagellar biosynthesis protein FlgJ	NA	NA	NA	NA
AUZ63324.1\|439798_440278_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
AUZ63325.1\|441650_445112_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
AUZ63326.1\|445187_446615_-	type VI secretion system protein TssA	NA	NA	NA	NA
AUZ63327.1\|446618_447362_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
AUZ63328.1\|447358_450049_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	4.4e-85	32.0
AUZ67671.1\|450059_450800_-	hypothetical protein	NA	NA	NA	NA
AUZ63329.1\|450882_452226_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
AUZ67672.1\|452228_452735_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
AUZ63330.1\|452758_454057_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
AUZ63331.1\|454061_455105_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
AUZ63332.1\|455071_456904_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
AUZ63333.1\|456909_457332_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA

DBSCAN-SWA_2

703248 : 710927

Pseudoalteromonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ63552.1\|703248_704226_+	calcium/sodium antiporter	A0A2D1GNI8	Pseudoalteromonas_phage	4.3e-06	22.3
AUZ63553.1\|704240_705227_+	arabinose-5-phosphate isomerase KdsD	A0A2P0VNK5	Tetraselmis_virus	5.1e-39	31.8
AUZ63554.1\|705247_705814_+	3-deoxy-manno-octulosonate-8-phosphatase KdsC	A0A140XBD6	Dickeya_phage	5.0e-55	76.5
AUZ63555.1\|705810_706386_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
AUZ63556.1\|706354_706909_+	lipopolysaccharide ABC transporter substrate-binding protein LptA	NA	NA	NA	NA
AUZ63557.1\|706915_707641_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.9e-22	28.4
AUZ63558.1\|707688_709122_+	RNA polymerase sigma-54 factor	NA	NA	NA	NA
AUZ63559.1\|709144_709432_+	ribosome hibernation promoting factor	A0A0M7QCF2	Escherichia_phage	4.2e-10	43.2
AUZ63560.1\|709547_710039_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
AUZ63561.1\|710072_710927_+	RNase adaptor protein RapZ	A0A0R8VB27	Thermobifida_phage	1.4e-05	28.4

DBSCAN-SWA_3

984740 : 994433

Stx2-converting_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ63823.1\|984740_987479_-	multidrug ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-20	29.5
AUZ63824.1\|987475_988543_-	hypothetical protein	NA	NA	NA	NA
AUZ63825.1\|988901_989309_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZCV4	Stx2-converting_phage	6.1e-15	37.8
AUZ63826.1\|989305_989656_+	IS66 family insertion sequence hypothetical protein	A0A0P0ZBY2	Stx2-converting_phage	3.3e-41	66.4
AUZ63827.1\|989686_991279_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.9e-181	63.8
AUZ63828.1\|991703_992138_-	copper-binding protein	NA	NA	NA	NA
AUZ63829.1\|992355_993756_-	sensor histidine kinase	W8CYF6	Bacillus_phage	3.2e-18	26.6
AUZ63830.1\|993752_994433_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	8.7e-30	34.4

DBSCAN-SWA_4

1729020 : 1748230

Bacteriophage(25.0%)

tRNA,transposase,integrase,holin

attL 1724153:1724167|attR 1752539:1752553

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1724153:1724167	attL	NA	NA	NA	NA
AUZ64446.1\|1729020_1730430_-	hypothetical protein	Q3LZN8	Bacteriophage	2.0e-214	74.7
AUZ64447.1\|1730556_1730859_-	VRR-NUC domain-containing protein	B6SD64	Bacteriophage	1.5e-26	67.1
AUZ64448.1\|1730863_1731052_-	hypothetical protein	NA	NA	NA	NA
AUZ64449.1\|1731048_1731339_-	hypothetical protein	NA	NA	NA	NA
AUZ64450.1\|1731331_1731550_-	hypothetical protein	NA	NA	NA	NA
AUZ64451.1\|1731555_1732542_-	hypothetical protein	B6SD65	Bacteriophage	1.3e-130	68.9
AUZ64452.1\|1733277_1734801_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.7e-44	31.8
AUZ64453.1\|1735094_1735505_+	hypothetical protein	NA	NA	NA	NA
AUZ64454.1\|1735896_1737048_-\|transposase	IS30-like element IS30H family transposase	W5R8L2	Staphylococcus_phage	1.7e-41	35.7
AUZ64455.1\|1737004_1737361_-	hypothetical protein	U5P4I9	Shigella_phage	2.6e-33	92.5
AUZ64456.1\|1738881_1739361_-	hypothetical protein	NA	NA	NA	NA
AUZ64457.1\|1740186_1741563_-	hypothetical protein	A0A1R3Y5Q6	Salmonella_virus	6.6e-85	45.5
AUZ64458.1\|1741783_1742014_+\|holin	holin	A5LH82	Enterobacteria_phage	3.3e-18	65.2
AUZ64459.1\|1741994_1742525_+	lysozyme	H6WRZ4	Salmonella_phage	8.4e-81	80.9
AUZ64460.1\|1742521_1742896_+	hypothetical protein	R9TPM9	Aeromonas_phage	6.7e-16	46.2
AUZ64461.1\|1742988_1744077_-\|integrase	integrase	A0A1W6JP34	Morganella_phage	1.3e-147	70.3
AUZ64462.1\|1744167_1745205_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
AUZ64463.1\|1745338_1745581_+	envelope stress response protein PspG	NA	NA	NA	NA
AUZ64464.1\|1745766_1746750_-	quinone oxidoreductase	NA	NA	NA	NA
AUZ64465.1\|1746814_1748230_+	replicative DNA helicase DnaB	O80281	Escherichia_phage	1.6e-198	77.5
1752539:1752553	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2398376 : 2407967

uncultured_Mediterranean_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ65045.1\|2398376_2399138_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.0e-60	48.8
AUZ65046.1\|2399131_2399758_+	protein-L-isoaspartate O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.5e-36	50.3
AUZ65047.1\|2399896_2401024_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	2.9e-06	35.6
AUZ65048.1\|2401902_2404911_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	0.0e+00	64.0
AUZ65049.1\|2405074_2405641_+	resolvase/recombinase	Q1MVP4	Enterobacteria_phage	3.5e-77	82.6
AUZ65050.1\|2405668_2406376_+	hypothetical protein	NA	NA	NA	NA
AUZ65051.1\|2406416_2407031_-	hypothetical protein	NA	NA	NA	NA
AUZ65052.1\|2407199_2407967_+	DUF1883 domain-containing protein	A0A097BYB4	Enterococcus_phage	1.6e-27	41.9

DBSCAN-SWA_6

2978236 : 3027935

Cronobacter_phage(67.5%)

transposase,integrase,holin,capsid,tail,terminase,portal,head

attL 2975601:2975615|attR 3018331:3018345

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2975601:2975615	attL	NA	NA	NA	NA
AUZ65522.1\|2978236_2978752_+	outer membrane protein OmpX	A5LH44	Enterobacteria_phage	8.3e-17	36.0
AUZ65523.1\|2978816_2980403_-	phosphoethanolamine transferase	NA	NA	NA	NA
AUZ65524.1\|2980680_2980809_-	manganase accumulation protein MntS	NA	NA	NA	NA
AUZ65525.1\|2980976_2982017_-\|integrase	integrase	A0A218M4I3	Erwinia_phage	8.1e-120	62.9
AUZ65526.1\|2982018_2982597_-	phage repressor protein	A0A218M4J1	Erwinia_phage	2.8e-29	40.1
AUZ65527.1\|2982716_2982938_+	regulator	NA	NA	NA	NA
AUZ65528.1\|2982968_2983472_+	hypothetical protein	F1BUN6	Cronobacter_phage	1.1e-58	71.3
AUZ65529.1\|2983481_2983709_+	hypothetical protein	NA	NA	NA	NA
AUZ65530.1\|2983698_2984127_+	hypothetical protein	F1BUN5	Cronobacter_phage	3.3e-27	53.3
AUZ65531.1\|2984126_2984528_+	hypothetical protein	F1BUN2	Cronobacter_phage	7.6e-50	67.7
AUZ65532.1\|2984595_2984829_+	hypothetical protein	NA	NA	NA	NA
AUZ65533.1\|2984819_2985416_+	3'-5' exonuclease	A0A1S6L012	Salmonella_phage	8.6e-82	76.2
AUZ65534.1\|2985412_2985742_+	hypothetical protein	Q2P9X4	Enterobacteria_phage	3.0e-12	45.2
AUZ65535.1\|2985731_2986592_+	adenine methylase	F1BUN1	Cronobacter_phage	4.9e-131	82.4
AUZ65536.1\|2986588_2988610_+	replication endonuclease	F1BUM9	Cronobacter_phage	4.4e-295	73.9
AUZ65537.1\|2988729_2989950_-\|transposase	ISL3 family transposase ISKox3	NA	NA	NA	NA
AUZ65538.1\|2990053_2990260_+	hypothetical protein	NA	NA	NA	NA
AUZ65539.1\|2990233_2990557_-	transcriptional regulator	F1BUM8	Cronobacter_phage	1.4e-49	92.3
AUZ65540.1\|2990553_2991615_-\|portal	phage portal protein	F1BUM7	Cronobacter_phage	3.8e-165	78.5
AUZ65541.1\|2991611_2993387_-\|terminase	terminase	F1BUM5	Cronobacter_phage	1.9e-294	84.3
AUZ65542.1\|2993547_2994351_+\|capsid	phage capsid protein	F1BUM4	Cronobacter_phage	4.2e-76	54.2
AUZ65543.1\|2994412_2995435_+\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	2.1e-160	82.1
AUZ65544.1\|2995436_2996138_+\|terminase	terminase	F1BUM0	Cronobacter_phage	3.8e-89	68.5
AUZ67781.1\|2996233_2996686_+\|head	head completion protein	F1BUL8	Cronobacter_phage	9.7e-62	80.7
AUZ65545.1\|2996682_2997189_+\|tail	phage tail protein	F1BUL7	Cronobacter_phage	9.5e-66	69.7
AUZ65546.1\|2997185_2997893_+	hypothetical protein	F1BUL6	Cronobacter_phage	2.3e-102	78.2
AUZ65547.1\|2997889_2999017_+	DUF2586 domain-containing protein	F1BUL5	Cronobacter_phage	3.8e-171	80.8
AUZ65548.1\|2999013_2999469_+	DUF2597 domain-containing protein	F1BUL4	Cronobacter_phage	1.9e-57	70.2
AUZ65549.1\|2999478_2999775_+\|holin	holin	C7BGD7	Burkholderia_phage	1.8e-16	50.6
AUZ65550.1\|2999771_3000113_+	hypothetical protein	F1BUL3	Cronobacter_phage	9.9e-51	92.1
AUZ65551.1\|3000112_3000451_+	hypothetical protein	F1BUL2	Cronobacter_phage	2.4e-28	62.3
AUZ65552.1\|3000422_3000611_+	hypothetical protein	F1BUL1	Cronobacter_phage	5.9e-21	75.8
AUZ65553.1\|3000597_3000855_+	hypothetical protein	A5X9I7	Aeromonas_virus	3.6e-21	63.4
AUZ65554.1\|3001042_3003010_+\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	1.5e-271	70.5
AUZ65555.1\|3003006_3003336_+	DUF2590 domain-containing protein	F1BUK8	Cronobacter_phage	1.4e-38	71.6
AUZ65556.1\|3003332_3004517_+	hypothetical protein	F1BUK6	Cronobacter_phage	2.4e-176	79.1
AUZ65557.1\|3004503_3005097_+	hypothetical protein	F1BUK5	Cronobacter_phage	7.7e-91	83.1
AUZ65558.1\|3005107_3006685_+\|tail	phage tail protein	F1BUK3	Cronobacter_phage	3.7e-132	78.7
AUZ65559.1\|3006684_3007272_+\|tail	phage tail protein	E5G6P1	Salmonella_phage	9.4e-57	56.0
AUZ65560.1\|3007261_3007987_+	hypothetical protein	F1BUK1	Cronobacter_phage	1.5e-59	52.7
AUZ65561.1\|3007958_3008504_+	hypothetical protein	F1BUJ9	Cronobacter_phage	5.3e-62	74.7
AUZ65562.1\|3008506_3010207_+	hypothetical protein	F1BUJ7	Cronobacter_phage	5.8e-224	80.2
AUZ67782.1\|3010340_3010541_+	hypothetical protein	NA	NA	NA	NA
AUZ65563.1\|3011699_3012173_+	transcriptional regulator MntR	NA	NA	NA	NA
AUZ65564.1\|3012169_3013279_+	anion transporter	NA	NA	NA	NA
AUZ65565.1\|3013344_3014265_-	L,D-transpeptidase	NA	NA	NA	NA
AUZ65566.1\|3014672_3014960_-	hypothetical protein	NA	NA	NA	NA
AUZ65567.1\|3014950_3015655_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ65568.1\|3015600_3015873_-	hypothetical protein	NA	NA	NA	NA
AUZ65569.1\|3015877_3016294_-	hypothetical protein	NA	NA	NA	NA
AUZ67783.1\|3016584_3017235_+	hypothetical protein	NA	NA	NA	NA
AUZ65570.1\|3017241_3018357_+	tellurium resistance protein	NA	NA	NA	NA
3018331:3018345	attR	NA	NA	NA	NA
AUZ65571.1\|3018380_3019355_+	hypothetical protein	NA	NA	NA	NA
AUZ65572.1\|3020161_3021287_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.4e-48	40.8
AUZ65573.1\|3021530_3022235_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ65574.1\|3022478_3023624_+	ABC transporter permease	NA	NA	NA	NA
AUZ67784.1\|3023620_3024421_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.8e-10	27.7
AUZ65575.1\|3024422_3025361_+	MCE family protein	NA	NA	NA	NA
AUZ65576.1\|3025360_3026002_+	ABC transporter	NA	NA	NA	NA
AUZ65577.1\|3027230_3027935_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0

DBSCAN-SWA_7

3042570 : 3154649

117

Cronobacter_phage(50.0%)

transposase,integrase,holin,capsid,tail,terminase,portal,protease,head

attL 3055130:3055150|attR 3124680:3124700

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ65600.1\|3042570_3043275_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ65601.1\|3043413_3043875_+	hypothetical protein	NA	NA	NA	NA
AUZ65602.1\|3043934_3044087_-	isocitrate dehydrogenase	Q77Z09	Phage_21	8.7e-15	82.0
AUZ65603.1\|3044829_3045408_+	resolvase	A0A1S5Y2X8	uncultured_archaeal_virus	1.6e-16	36.2
AUZ65604.1\|3045892_3046072_-	hypothetical protein	NA	NA	NA	NA
AUZ65605.1\|3046255_3046978_-	hypothetical protein	NA	NA	NA	NA
AUZ65606.1\|3047088_3047793_-\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ65607.1\|3048863_3049793_-	glycosyltransferase	U5P087	Shigella_phage	7.7e-154	86.5
AUZ65608.1\|3049789_3050152_-	translocase	F1C5B1	Cronobacter_phage	3.6e-43	70.8
AUZ65609.1\|3051380_3051749_-	hypothetical protein	NA	NA	NA	NA
AUZ65610.1\|3051738_3052584_-	hypothetical protein	NA	NA	NA	NA
AUZ65611.1\|3053081_3054569_-	recombinase family protein	NA	NA	NA	NA
AUZ65612.1\|3054603_3056199_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	6.5e-60	28.7
3055130:3055150	attL	NA	NA	NA	NA
AUZ65613.1\|3056224_3056446_+	hypothetical protein	NA	NA	NA	NA
AUZ65614.1\|3056380_3058759_-	alpha-glucosidase	NA	NA	NA	NA
AUZ65615.1\|3058761_3060063_-	MFS transporter	NA	NA	NA	NA
AUZ65616.1\|3060348_3061422_+	LacI family transcriptional regulator	NA	NA	NA	NA
AUZ65617.1\|3061418_3062681_-	DUF1479 domain-containing protein	NA	NA	NA	NA
AUZ65618.1\|3062829_3063645_-	sugar-phosphatase	NA	NA	NA	NA
AUZ65619.1\|3063791_3066224_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A076YHZ7	Citrobacter_phage	2.3e-08	50.9
AUZ65620.1\|3066228_3067128_-	glycyl-radical enzyme activating protein	NA	NA	NA	NA
AUZ65621.1\|3067259_3067922_+	fructose-6-phosphate aldolase	C7BV14	Synechococcus_phage	2.5e-26	32.4
AUZ65622.1\|3068010_3068769_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
AUZ65623.1\|3068768_3070004_-	molybdopterin molybdotransferase	NA	NA	NA	NA
AUZ65624.1\|3070188_3071154_+	beta-aspartyl-peptidase	NA	NA	NA	NA
AUZ65625.1\|3071140_3073012_+	glutathione ABC transporter ATP-binding protein GsiA	G9BWD6	Planktothrix_phage	4.4e-15	30.0
AUZ65626.1\|3073040_3074579_+	glutathione ABC transporter substrate-binding protein GsiB	NA	NA	NA	NA
AUZ65627.1\|3074596_3075517_+	glutathione ABC transporter permease GsiC	NA	NA	NA	NA
AUZ65628.1\|3075519_3076431_+	glutathione ABC transporter permease GsiD	NA	NA	NA	NA
AUZ65629.1\|3076518_3077844_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
AUZ65630.1\|3078074_3078458_+	transcriptional regulator	NA	NA	NA	NA
AUZ65631.1\|3078563_3079679_+	PQQ-dependent sugar dehydrogenase	NA	NA	NA	NA
AUZ65632.1\|3079684_3080311_-	glutathione S-transferase family protein	NA	NA	NA	NA
AUZ67787.1\|3080558_3081761_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	9.1e-99	47.1
AUZ65633.1\|3081809_3082568_-	DNA-binding transcriptional repressor DeoR	A0A077SK06	Escherichia_phage	1.1e-12	28.1
AUZ65634.1\|3082639_3083248_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
AUZ65635.1\|3083541_3084774_+	multidrug transporter MdfA	NA	NA	NA	NA
AUZ65636.1\|3084870_3085683_-	HAD family hydrolase	NA	NA	NA	NA
AUZ65637.1\|3085683_3086892_-	MFS transporter	NA	NA	NA	NA
AUZ65638.1\|3086973_3087513_+	DNA-binding transcriptional regulator	NA	NA	NA	NA
AUZ65639.1\|3087738_3088788_-\|integrase	integrase	A0A218M4I3	Erwinia_phage	1.7e-104	56.4
AUZ65640.1\|3088864_3089485_-	CI repressor	A0A1S6KZZ7	Salmonella_phage	1.3e-29	35.4
AUZ65641.1\|3089620_3089842_+	regulator	NA	NA	NA	NA
AUZ65642.1\|3089874_3090378_+	hypothetical protein	F1BUN6	Cronobacter_phage	1.2e-52	64.7
AUZ65643.1\|3090387_3090615_+	hypothetical protein	NA	NA	NA	NA
AUZ65644.1\|3090604_3091045_+	hypothetical protein	F1BUN5	Cronobacter_phage	1.1e-22	48.4
AUZ65645.1\|3091041_3091443_+	hypothetical protein	F1BUN2	Cronobacter_phage	1.5e-45	65.2
AUZ65646.1\|3091507_3091741_+	hypothetical protein	NA	NA	NA	NA
AUZ67788.1\|3091879_3092209_+	hypothetical protein	C9E2N9	Enterococcus_phage	2.0e-11	46.8
AUZ65647.1\|3092198_3093002_+	adenine methylase	F1BUN1	Cronobacter_phage	3.1e-95	65.6
AUZ65648.1\|3092998_3095023_+	replication endonuclease	F1BUM9	Cronobacter_phage	4.0e-288	72.2
AUZ65649.1\|3095142_3095361_+	hypothetical protein	NA	NA	NA	NA
AUZ65650.1\|3095334_3095658_-	transcriptional regulator	F1BUM8	Cronobacter_phage	5.3e-46	84.6
AUZ65651.1\|3095654_3096704_-\|portal	phage portal protein	F1BUM7	Cronobacter_phage	3.6e-160	79.3
AUZ65652.1\|3096700_3098476_-\|terminase	terminase	F1BUM5	Cronobacter_phage	1.9e-294	89.5
AUZ65653.1\|3098648_3099449_+\|capsid	phage capsid protein	F1BUM4	Cronobacter_phage	2.0e-65	53.4
AUZ65654.1\|3099509_3100532_+\|capsid	phage major capsid protein, P2 family	F1BUM2	Cronobacter_phage	3.2e-161	84.1
AUZ65655.1\|3100535_3101237_+\|terminase	terminase	F1BUM0	Cronobacter_phage	5.3e-83	65.1
AUZ65656.1\|3101334_3101787_+\|head	head completion protein	F1BUL8	Cronobacter_phage	4.4e-62	80.7
AUZ65657.1\|3101783_3102296_+\|tail	phage tail protein	F1BUL7	Cronobacter_phage	3.5e-60	64.8
AUZ65658.1\|3102292_3103000_+	hypothetical protein	F1BUL6	Cronobacter_phage	2.2e-100	76.9
AUZ65659.1\|3102996_3104124_+	DUF2586 domain-containing protein	F1BUL5	Cronobacter_phage	9.3e-170	79.5
AUZ65660.1\|3104120_3104576_+	DUF2597 domain-containing protein	F1BUL4	Cronobacter_phage	3.3e-57	72.2
AUZ65661.1\|3104585_3104879_+\|holin	holin	A0A0M5M1H1	Salmonella_phage	7.8e-20	55.8
AUZ65662.1\|3104875_3105217_+	hypothetical protein	F1BUL3	Cronobacter_phage	1.5e-51	92.1
AUZ65663.1\|3105216_3105549_+	hypothetical protein	F1BUL2	Cronobacter_phage	2.7e-37	73.6
AUZ67789.1\|3105475_3105709_+	hypothetical protein	F1BUL1	Cronobacter_phage	3.7e-33	87.0
AUZ65664.1\|3105695_3105953_+	hypothetical protein	A5X9I7	Aeromonas_virus	2.5e-22	65.9
AUZ65665.1\|3106140_3108021_+\|tail	phage tail tape measure protein	F1BUK9	Cronobacter_phage	2.4e-247	65.5
AUZ65666.1\|3108020_3108350_+	DUF2590 domain-containing protein	F1BUK8	Cronobacter_phage	1.2e-37	72.5
AUZ65667.1\|3108346_3109531_+	hypothetical protein	F1BUK6	Cronobacter_phage	4.8e-169	75.1
AUZ65668.1\|3109523_3110111_+	hypothetical protein	F1BUK5	Cronobacter_phage	5.1e-87	76.9
AUZ65669.1\|3110120_3111722_+	hypothetical protein	F1BUK3	Cronobacter_phage	8.1e-127	74.4
AUZ67790.1\|3111724_3112165_+\|tail	tail fiber assembly protein	B6SCW7	Bacteriophage	2.1e-24	43.7
AUZ65670.1\|3112154_3112880_+	hypothetical protein	F1BUK1	Cronobacter_phage	6.1e-66	55.6
AUZ65671.1\|3112851_3113397_+	hypothetical protein	F1BUJ9	Cronobacter_phage	2.4e-59	71.3
AUZ65672.1\|3113399_3115079_+	hypothetical protein	F1BUJ7	Cronobacter_phage	2.4e-198	68.0
AUZ67791.1\|3115242_3115461_+	hypothetical protein	NA	NA	NA	NA
AUZ65673.1\|3115603_3116101_-	hypothetical protein	NA	NA	NA	NA
AUZ65674.1\|3116243_3117020_+	hypothetical protein	NA	NA	NA	NA
AUZ65675.1\|3117266_3118952_-	transporter	NA	NA	NA	NA
AUZ65676.1\|3119220_3119598_+	hypothetical protein	NA	NA	NA	NA
AUZ65677.1\|3119637_3119901_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	3.5e-27	70.5
AUZ65678.1\|3120073_3120361_+	hypothetical protein	NA	NA	NA	NA
AUZ65679.1\|3120344_3121067_+	oxygen-insensitive NADPH nitroreductase	NA	NA	NA	NA
AUZ65680.1\|3121127_3122030_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	7.4e-37	34.9
AUZ65681.1\|3122120_3122597_+	YbjN domain-containing protein	NA	NA	NA	NA
AUZ65682.1\|3122961_3124074_+	spermidine/putrescine ABC transporter substrate-binding protein PotF	NA	NA	NA	NA
AUZ65683.1\|3124171_3125305_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.5e-30	34.4
3124680:3124700	attR	NA	NA	NA	NA
AUZ65684.1\|3125314_3126268_+	putrescine ABC transporter permease PotH	NA	NA	NA	NA
AUZ65685.1\|3126264_3127110_+	putrescine ABC transporter permease PotI	NA	NA	NA	NA
AUZ65686.1\|3127169_3127658_+	DUF2593 domain-containing protein	NA	NA	NA	NA
AUZ65687.1\|3127698_3128844_+	23S rRNA (uracil(747)-C(5))-methyltransferase RlmC	A0A1X9I6F4	Streptococcus_phage	7.3e-29	26.7
AUZ65688.1\|3128938_3129670_-	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUZ65689.1\|3129839_3130508_-	arginine transporter permease subunit ArtM	NA	NA	NA	NA
AUZ65690.1\|3130507_3131224_-	arginine transporter permease subunit ArtQ	NA	NA	NA	NA
AUZ65691.1\|3131230_3131962_-	arginine ABC transporter substrate-binding protein	NA	NA	NA	NA
AUZ65692.1\|3131978_3132707_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	5.1e-28	36.9
AUZ65693.1\|3132936_3133452_-	lipoprotein	NA	NA	NA	NA
AUZ65694.1\|3133580_3133904_+	hypothetical protein	NA	NA	NA	NA
AUZ65695.1\|3133900_3134731_+	N-acetylmuramoyl-L-alanine amidase	A0A1B0UZW5	Roseobacter_phage	6.7e-08	31.8
AUZ65696.1\|3134727_3135741_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
AUZ65697.1\|3135833_3137270_-	DUF2867 domain-containing protein	NA	NA	NA	NA
AUZ65698.1\|3137280_3138282_-	low-specificity L-threonine aldolase	NA	NA	NA	NA
AUZ65699.1\|3138320_3140039_-	ubiquinone-dependent pyruvate dehydrogenase	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	9.9e-30	24.0
AUZ65700.1\|3140190_3140625_+	GntR family transcriptional regulator	NA	NA	NA	NA
AUZ65701.1\|3140657_3141626_-	NADH oxidoreductase	NA	NA	NA	NA
AUZ65702.1\|3141636_3143289_-	hydroxylamine reductase	NA	NA	NA	NA
AUZ65703.1\|3143432_3144332_-	DUF340 domain-containing protein	NA	NA	NA	NA
AUZ67792.1\|3144478_3145174_-	aquaporin Z	NA	NA	NA	NA
AUZ65704.1\|3145587_3147246_+	ATP-dependent endonuclease	NA	NA	NA	NA
AUZ67793.1\|3147242_3148193_-	DUF535 domain-containing protein	NA	NA	NA	NA
AUZ67794.1\|3148344_3149457_+	macrolide transporter subunit MacA	NA	NA	NA	NA
AUZ65705.1\|3149453_3151400_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	5.9e-39	41.3
AUZ65706.1\|3151475_3151697_-	cold shock domain protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.6e-17	62.7
AUZ65707.1\|3152020_3152341_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	1.6e-13	44.9
AUZ65708.1\|3152372_3154649_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.1e-166	42.6

DBSCAN-SWA_8

3188456 : 3301290

119

Enterobacteria_phage(31.15%)

transposase,tRNA,holin,integrase,capsid,tail,terminase,portal,protease,head

attL 3294671:3294730|attR 3308973:3309039

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ65732.1\|3188456_3189218_+\|protease	metalloprotease	NA	NA	NA	NA
AUZ65733.1\|3189390_3190074_+	cytidylate kinase	NA	NA	NA	NA
AUZ65734.1\|3190187_3191861_+	30S ribosomal protein S1	NA	NA	NA	NA
AUZ65735.1\|3192008_3192293_+	integration host factor subunit beta	A7KV42	Bacillus_phage	7.1e-10	39.1
AUZ65736.1\|3192497_3194762_+	ComEC family protein	NA	NA	NA	NA
AUZ65737.1\|3194798_3196547_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	6.4e-61	30.7
AUZ65738.1\|3196543_3197521_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
AUZ65739.1\|3197562_3198795_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUZ65740.1\|3198846_3199029_+	protein YcaR	NA	NA	NA	NA
AUZ65741.1\|3199025_3199772_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
AUZ65742.1\|3199924_3200818_+	hypothetical protein	NA	NA	NA	NA
AUZ65743.1\|3200794_3201574_-	envelope biogenesis factor ElyC	NA	NA	NA	NA
AUZ65744.1\|3201709_3202489_+\|tRNA	tRNA uridine 5-oxyacetic acid(34) methyltransferase CmoM	NA	NA	NA	NA
AUZ65745.1\|3202492_3203815_+	chromosome partition protein MukF	NA	NA	NA	NA
AUZ65746.1\|3203795_3204500_+	chromosome partition protein MukE	NA	NA	NA	NA
AUZ65747.1\|3204499_3208960_+	chromosome partition protein MukB	NA	NA	NA	NA
AUZ65748.1\|3209132_3210983_+	L,D-transpeptidase	NA	NA	NA	NA
AUZ65749.1\|3211159_3211708_+	DUF882 domain-containing protein	A0A0K1LKR7	Rhodobacter_phage	4.1e-06	33.7
AUZ65750.1\|3211727_3212375_+	hypothetical protein	NA	NA	NA	NA
AUZ65751.1\|3212424_3213615_-	aspartate/tyrosine/aromatic aminotransferase	NA	NA	NA	NA
AUZ65752.1\|3215507_3216917_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	2.4e-82	36.8
AUZ65753.1\|3217079_3218282_-	nicotinate phosphoribosyltransferase	NA	NA	NA	NA
AUZ65754.1\|3218476_3219769_-\|integrase	integrase	S4TSP2	Salmonella_phage	2.8e-239	94.4
AUZ65755.1\|3219813_3220062_-	excisionase	S4TND0	Salmonella_phage	3.2e-35	83.8
AUZ65756.1\|3220208_3220571_-	hypothetical protein	NA	NA	NA	NA
AUZ65757.1\|3220570_3221032_-	ATPase	A0A1B5FPC7	Escherichia_phage	1.9e-44	52.2
AUZ65758.1\|3221028_3221253_-	hypothetical protein	A0A1B5FPG2	Escherichia_phage	3.3e-18	66.7
AUZ65759.1\|3221249_3222080_-	DNA-binding protein	A0A2L1IV39	Escherichia_phage	2.3e-32	68.7
AUZ65760.1\|3222091_3222670_-	hypothetical protein	A0A286S1S7	Klebsiella_phage	7.8e-64	60.5
AUZ65761.1\|3222666_3223074_-	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.2e-28	52.9
AUZ65762.1\|3223518_3223875_-	hypothetical protein	A0A1B5FPB3	Escherichia_phage	7.0e-23	49.6
AUZ65763.1\|3223864_3224065_-	hypothetical protein	NA	NA	NA	NA
AUZ65764.1\|3224252_3224675_-	hypothetical protein	A0A1B5FPB2	Escherichia_phage	1.5e-08	54.1
AUZ65765.1\|3224671_3224875_-	hypothetical protein	NA	NA	NA	NA
AUZ65766.1\|3225247_3225955_-	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	3.3e-96	74.5
AUZ65767.1\|3226068_3226287_+	hypothetical protein	NA	NA	NA	NA
AUZ65768.1\|3226411_3226732_-	hypothetical protein	NA	NA	NA	NA
AUZ65769.1\|3227072_3227930_+	hypothetical protein	Q8W644	Enterobacteria_phage	7.5e-63	70.7
AUZ65770.1\|3227926_3228742_+	helix-turn-helix domain-containing protein	A5LH71	Enterobacteria_phage	1.2e-89	66.3
AUZ65771.1\|3228756_3229638_+	AAA family ATPase	Q8W641	Enterobacteria_phage	2.6e-79	61.6
AUZ65772.1\|3229634_3231017_+	helicase	Q8W640	Enterobacteria_phage	3.4e-174	68.4
AUZ65773.1\|3231003_3231369_+	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	1.8e-37	62.3
AUZ65774.1\|3231368_3232184_+	antitermination protein	A0A1B5FPA5	Escherichia_phage	5.2e-114	73.1
AUZ65775.1\|3232339_3232597_+	hypothetical protein	Q8HA88	Salmonella_phage	1.9e-30	76.5
AUZ65776.1\|3232514_3232961_-	hypothetical protein	NA	NA	NA	NA
AUZ65777.1\|3233181_3233505_+\|holin	phage holin, lambda family	G5DA93	Enterobacteria_phage	3.6e-42	84.5
AUZ65778.1\|3233488_3233938_+	lysozyme	A0A0M4R365	Salmonella_phage	3.2e-65	80.5
AUZ65779.1\|3233934_3234465_+	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	8.0e-07	47.0
AUZ65780.1\|3234819_3235020_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	8.4e-18	71.7
AUZ65781.1\|3235079_3235415_+	hypothetical protein	S4TTH3	Salmonella_phage	1.6e-37	64.0
AUZ65782.1\|3235550_3236102_+	HNH endonuclease	Q7Y5F9	Xanthomonas_virus	5.2e-33	41.5
AUZ65783.1\|3236115_3236643_+	hypothetical protein	M9NZE9	Enterobacteria_phage	4.0e-06	54.7
AUZ65784.1\|3236658_3236886_+	hypothetical protein	NA	NA	NA	NA
AUZ65785.1\|3236905_3238363_+	glycosyltransferase	K7PKP3	Enterobacterial_phage	2.8e-243	82.9
AUZ65786.1\|3238347_3238935_+	hypothetical protein	S4TR53	Salmonella_phage	1.1e-89	77.8
AUZ65787.1\|3238934_3239291_+	HNH endonuclease	K7PHK9	Enterobacteria_phage	1.7e-48	78.1
AUZ65788.1\|3239419_3239956_+	hypothetical protein	NA	NA	NA	NA
AUZ65789.1\|3240111_3240609_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	4.2e-74	84.8
AUZ65790.1\|3240608_3242345_+\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	99.5
AUZ65791.1\|3242344_3243649_+\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	2.5e-235	94.0
AUZ65792.1\|3243662_3244511_+	peptidase S14	K7PH05	Enterobacteria_phage	1.8e-138	91.8
AUZ65793.1\|3244520_3245729_+\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	6.2e-196	88.2
AUZ65794.1\|3245771_3246098_+	hypothetical protein	K7PKT4	Enterobacteria_phage	6.6e-52	88.9
AUZ65795.1\|3246161_3246374_+	hypothetical protein	K7PGR0	Enterobacteria_phage	9.6e-12	62.9
AUZ65796.1\|3246375_3246708_+\|head,tail	head-tail adaptor protein	K7PH08	Enterobacteria_phage	6.5e-55	93.6
AUZ65797.1\|3246700_3247240_+	hypothetical protein	K7PM60	Enterobacteria_phage	5.2e-86	91.1
AUZ65798.1\|3247236_3247602_+	hypothetical protein	A0A286S1R1	Klebsiella_phage	7.6e-49	71.9
AUZ65799.1\|3247660_3248158_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	1.1e-63	71.9
AUZ65800.1\|3248210_3248591_+\|tail	phage tail protein	K7PJU9	Enterobacteria_phage	4.5e-44	77.1
AUZ65801.1\|3248575_3248878_+\|tail	phage tail protein	Q9MCU7	Escherichia_phage	7.2e-29	62.2
AUZ65802.1\|3248945_3249233_+	hypothetical protein	NA	NA	NA	NA
AUZ65803.1\|3250171_3251152_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	6.8e-185	98.8
AUZ65804.1\|3252950_3253544_+	hypothetical protein	S4TSP7	Salmonella_phage	1.1e-100	86.8
AUZ65805.1\|3253543_3254128_+	hypothetical protein	S4TND4	Salmonella_phage	1.2e-96	88.1
AUZ65806.1\|3254134_3254533_+	hypothetical protein	S4TR39	Salmonella_phage	2.1e-60	81.8
AUZ65807.1\|3254532_3257244_+\|tail	phage tail protein	S4TTF5	Salmonella_phage	0.0e+00	84.9
AUZ65808.1\|3257251_3258208_+	hypothetical protein	I6S634	Salmonella_phage	1.4e-105	61.9
AUZ65809.1\|3259116_3259734_+\|tail	phage tail protein	NA	NA	NA	NA
AUZ65810.1\|3259863_3260103_-	DinI family protein	K7P6H1	Enterobacteria_phage	1.9e-32	88.6
AUZ65811.1\|3260531_3263144_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	5.3e-19	21.7
AUZ65812.1\|3263249_3264017_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-30	38.0
AUZ65813.1\|3264013_3264805_-	aliphatic sulfonate ABC transporter permease SsuC	NA	NA	NA	NA
AUZ65814.1\|3264816_3265962_-	alkanesulfonate monooxygenase, FMNH(2)-dependent	NA	NA	NA	NA
AUZ65815.1\|3265958_3266933_-	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AUZ65816.1\|3266925_3267501_-	NADPH-dependent FMN reductase	NA	NA	NA	NA
AUZ65817.1\|3267744_3268755_+	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
AUZ65818.1\|3268934_3269477_+	cell division protein ZapC	NA	NA	NA	NA
AUZ65819.1\|3269473_3270583_-	MOSC domain-containing protein	E3SNZ1	Prochlorococcus_phage	1.9e-05	36.0
AUZ65820.1\|3270680_3272789_+	bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL	NA	NA	NA	NA
AUZ65821.1\|3272801_3274709_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	2.9e-54	29.7
AUZ65822.1\|3274723_3275977_+	paraquat-inducible protein A	NA	NA	NA	NA
AUZ65823.1\|3275981_3277622_+	paraquat-inducible protein B	NA	NA	NA	NA
AUZ65824.1\|3277618_3278182_+	hypothetical protein	NA	NA	NA	NA
AUZ65825.1\|3278439_3278607_+	ribosome modulation factor	NA	NA	NA	NA
AUZ65826.1\|3278702_3279221_-	beta-hydroxydecanoyl-ACP dehydratase	NA	NA	NA	NA
AUZ65827.1\|3279289_3281050_-\|protease	Lon protease	NA	NA	NA	NA
AUZ65828.1\|3281235_3281688_+	macrodomain Ter protein MatP	NA	NA	NA	NA
AUZ65829.1\|3281764_3282877_-	porin OmpA	NA	NA	NA	NA
AUZ65830.1\|3283175_3283685_-	cell division inhibitor SulA	NA	NA	NA	NA
AUZ65831.1\|3283902_3284532_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
AUZ65832.1\|3284485_3286648_-	TIGR01666 family membrane protein	NA	NA	NA	NA
AUZ65833.1\|3286654_3287113_-	YccF domain-containing protein	NA	NA	NA	NA
AUZ65834.1\|3287236_3289291_+	DNA helicase IV	A7KV33	Bacillus_phage	3.2e-19	27.9
AUZ65835.1\|3289322_3289781_-	methylglyoxal synthase	NA	NA	NA	NA
AUZ65836.1\|3289873_3290536_-	DUF2057 domain-containing protein	NA	NA	NA	NA
AUZ65837.1\|3290708_3291122_+	CoA-binding protein	NA	NA	NA	NA
AUZ65838.1\|3291190_3291508_-	heat shock protein HspQ	NA	NA	NA	NA
AUZ65839.1\|3291565_3292756_-	23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI	NA	NA	NA	NA
AUZ65840.1\|3292850_3293132_+	acylphosphatase	NA	NA	NA	NA
AUZ65841.1\|3293128_3293458_-	sulfurtransferase TusE	NA	NA	NA	NA
AUZ65842.1\|3293708_3294368_-	transmembrane protein	A0A2H4JFM9	uncultured_Caudovirales_phage	4.4e-47	54.9
3294671:3294730	attL	NA	NA	NA	NA
AUZ65843.1\|3294835_3295855_-\|integrase	integrase	A0A192Y7M7	Salmonella_phage	1.3e-93	54.7
AUZ65844.1\|3295855_3296080_-	DUF4224 domain-containing protein	NA	NA	NA	NA
AUZ65845.1\|3296045_3296243_-	hypothetical protein	H9C154	Pectobacterium_phage	8.3e-10	58.5
AUZ65846.1\|3296292_3296475_-	hypothetical protein	NA	NA	NA	NA
AUZ65847.1\|3296476_3297031_-	hypothetical protein	H9C156	Pectobacterium_phage	2.8e-50	61.0
AUZ67797.1\|3298942_3299476_+	hypothetical protein	NA	NA	NA	NA
AUZ65848.1\|3299488_3299899_+	hypothetical protein	Q7Y4D3	Escherichia_virus	3.1e-14	47.9
AUZ65849.1\|3300069_3301290_+\|transposase	ISL3 family transposase ISKox3	NA	NA	NA	NA
3308973:3309039	attR	NA	NA	NA	NA

DBSCAN-SWA_9

3329518 : 3362369

Vibrio_phage(67.65%)

plate,transposase,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ65873.1\|3329518_3329755_+	DNA-binding protein	A0A2I7S995	Vibrio_phage	1.9e-13	58.7
AUZ65874.1\|3329755_3331741_+\|transposase	transposase	C9DGL1	Escherichia_phage	6.0e-188	51.7
AUZ65875.1\|3331819_3332758_+	hypothetical protein	A0A0C4UQR3	Shigella_phage	1.3e-76	48.7
AUZ65876.1\|3332762_3333002_+	hypothetical protein	A0A0C4UQY4	Shigella_phage	2.8e-15	55.4
AUZ65877.1\|3333004_3333256_+	hypothetical protein	NA	NA	NA	NA
AUZ65878.1\|3333263_3333791_+	host-nuclease inhibitor protein Gam	C9DGL8	Escherichia_phage	3.7e-44	56.7
AUZ65879.1\|3334486_3334708_+	hypothetical protein	NA	NA	NA	NA
AUZ65880.1\|3334704_3335232_+	regulatory protein GemA	A0A0C4UQU3	Shigella_phage	3.8e-41	48.1
AUZ65881.1\|3335228_3335639_+	transcriptional regulator	A0A0C4UR27	Shigella_phage	1.8e-38	63.5
AUZ65882.1\|3335642_3336152_+	hypothetical protein	NA	NA	NA	NA
AUZ65883.1\|3336262_3336853_+	peptidoglycan-binding protein	A0A2I7S9B9	Vibrio_phage	7.0e-36	45.1
AUZ65884.1\|3336854_3337073_+	hypothetical protein	A0A0C4UQR6	Shigella_phage	3.2e-26	72.2
AUZ65885.1\|3337065_3337473_+	hypothetical protein	NA	NA	NA	NA
AUZ65886.1\|3337460_3338069_+	hypothetical protein	NA	NA	NA	NA
AUZ65887.1\|3338065_3338272_+	conjugal transfer protein TraR	NA	NA	NA	NA
AUZ65888.1\|3338272_3338578_+	DUF2730 domain-containing protein	M1Q558	Vibrio_phage	1.3e-12	36.2
AUZ65889.1\|3338589_3338877_+	hypothetical protein	M1PPT9	Vibrio_phage	1.1e-26	64.5
AUZ65890.1\|3338879_3339257_+	hypothetical protein	NA	NA	NA	NA
AUZ65891.1\|3339246_3339519_+	hypothetical protein	NA	NA	NA	NA
AUZ65892.1\|3339508_3340087_+	hypothetical protein	M4MCR3	Vibrio_phage	6.4e-42	51.8
AUZ65893.1\|3340083_3341667_+	hypothetical protein	M4MHG0	Vibrio_phage	7.8e-199	68.9
AUZ65894.1\|3341666_3343235_+	DUF935 domain-containing protein	A0A2I7S9K0	Vibrio_phage	8.1e-156	54.8
AUZ65895.1\|3343227_3344022_+	hypothetical protein	M4M9M5	Vibrio_phage	3.9e-90	57.5
AUZ65896.1\|3344225_3345182_+	peptidase	M1Q578	Vibrio_phage	1.4e-81	51.4
AUZ65897.1\|3345185_3346079_+\|head	phage head protein	M4MB71	Vibrio_phage	1.5e-93	55.4
AUZ65898.1\|3346162_3346765_+	hypothetical protein	NA	NA	NA	NA
AUZ65899.1\|3346764_3347205_+	DUF1320 domain-containing protein	A0A2I7S9E9	Vibrio_phage	4.9e-34	48.6
AUZ65900.1\|3347204_3347747_+	phage morphogenesis protein	A0A2I7S9D7	Vibrio_phage	2.1e-55	60.3
AUZ65901.1\|3347743_3348355_+	hypothetical protein	M4MHF0	Vibrio_phage	8.0e-35	43.5
AUZ65902.1\|3348347_3348536_+	hypothetical protein	NA	NA	NA	NA
AUZ65903.1\|3348535_3350014_+\|tail	phage tail protein	M1Q565	Vibrio_phage	2.1e-153	54.4
AUZ65904.1\|3350023_3350380_+\|tail	phage tail protein	A0A2I7S9D5	Vibrio_phage	5.9e-22	43.8
AUZ65905.1\|3350383_3350779_+	hypothetical protein	M4MB64	Vibrio_phage	3.1e-19	42.9
AUZ65906.1\|3350865_3352785_+\|tail	phage tail protein	M4MHE6	Vibrio_phage	3.4e-55	34.6
AUZ65907.1\|3352784_3354116_+	multidrug DMT transporter	A0A2I7S9E8	Vibrio_phage	7.0e-76	36.8
AUZ65908.1\|3354115_3355207_+\|tail	phage tail protein	M1PVV2	Vibrio_phage	7.8e-89	45.9
AUZ65909.1\|3355197_3355740_+\|plate	phage baseplate protein	M1Q572	Vibrio_phage	4.9e-28	40.4
AUZ65910.1\|3355736_3356189_+	hypothetical protein	M1PPW1	Vibrio_phage	4.0e-23	42.8
AUZ65911.1\|3356178_3357255_+\|plate	phage baseplate protein	A0A2I7S9E5	Vibrio_phage	3.3e-100	52.7
AUZ65912.1\|3357239_3357830_+	hypothetical protein	M1NVS6	Vibrio_phage	1.6e-51	51.3
AUZ65913.1\|3358499_3358916_+\|tail	phage tail protein	A0A218M4J2	Erwinia_phage	8.5e-12	50.0
AUZ65914.1\|3358887_3359313_-\|tail	tail fiber assembly protein	A0A0F7LDZ0	Escherichia_phage	4.0e-17	38.0
AUZ65915.1\|3359732_3360287_+	DNA-invertase	A0A1S6L009	Salmonella_phage	4.4e-80	83.5
AUZ67800.1\|3360949_3361210_+	acyl carrier protein	NA	NA	NA	NA
AUZ65916.1\|3361196_3362369_+	aminotransferase class V-fold PLP-dependent enzyme	D2TEZ5	Emiliania_huxleyi_virus	1.7e-36	29.2

DBSCAN-SWA_10

4109024 : 4173237

Shigella_phage(46.51%)

transposase,tail,plate,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ66584.1\|4109024_4110101_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUZ66585.1\|4110075_4110312_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
AUZ66586.1\|4110515_4111250_+	flagellar brake protein	NA	NA	NA	NA
AUZ66587.1\|4111250_4111862_-	membrane-bound lytic murein transglycosylase EmtA	NA	NA	NA	NA
AUZ66588.1\|4112000_4112915_+	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
AUZ66589.1\|4113012_4114749_+	potassium/proton antiporter	NA	NA	NA	NA
AUZ66590.1\|4114858_4115929_-	alanine racemase	NA	NA	NA	NA
AUZ66591.1\|4115941_4117240_-	D-amino acid dehydrogenase small subunit	NA	NA	NA	NA
AUZ66592.1\|4117568_4119101_+	SpoVR family protein	NA	NA	NA	NA
AUZ66593.1\|4119134_4119854_-	fatty acid metabolism transcriptional regulator FadR	NA	NA	NA	NA
AUZ66594.1\|4120076_4121621_+	Na(+)/H(+) antiporter NhaB	NA	NA	NA	NA
AUZ66595.1\|4121762_4122293_+	disulfide bond formation protein DsbB	NA	NA	NA	NA
AUZ66596.1\|4122516_4122978_-	YcgN family cysteine cluster protein	NA	NA	NA	NA
AUZ66597.1\|4123055_4123715_-	isomerase/hydrolase	NA	NA	NA	NA
AUZ66598.1\|4123783_4124077_-	hypothetical protein	NA	NA	NA	NA
AUZ66599.1\|4124203_4124911_+	septum site-determining protein MinC	NA	NA	NA	NA
AUZ66600.1\|4124934_4125747_+	septum site-determining protein MinD	NA	NA	NA	NA
AUZ66601.1\|4125750_4126017_+	cell division topological specificity factor MinE	NA	NA	NA	NA
AUZ66602.1\|4126121_4126922_-	aminoglycoside nucleotidyltransferase ANT9	NA	NA	NA	NA
AUZ66603.1\|4126999_4127650_-	metal-binding protein ZinT	NA	NA	NA	NA
AUZ66604.1\|4127815_4128244_+	universal stress protein UspF	A0A1W6JNV4	Morganella_phage	1.6e-26	47.9
AUZ66605.1\|4128273_4129134_-	LysR family transcriptional regulator	NA	NA	NA	NA
AUZ66606.1\|4129325_4130210_+	SED family class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	7.4e-106	70.6
AUZ66607.1\|4130522_4131152_-	transcriptional regulator	NA	NA	NA	NA
AUZ66608.1\|4131204_4132185_-	serine dehydratase	NA	NA	NA	NA
AUZ66609.1\|4132216_4132606_-	RidA family protein	NA	NA	NA	NA
AUZ66610.1\|4132834_4133671_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
AUZ66611.1\|4133735_4135001_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	3.8e-204	81.5
AUZ66612.1\|4135390_4135810_-	translesion error-prone DNA polymerase V subunit UmuD	A0A1W6JNS2	Morganella_phage	2.2e-36	60.5
AUZ66613.1\|4136063_4136246_-	DUF1869 domain-containing protein	NA	NA	NA	NA
AUZ66614.1\|4136248_4136611_-	DUF1971 domain-containing protein	NA	NA	NA	NA
AUZ66615.1\|4136778_4138056_-	hypothetical protein	A0A1R3Y5Q6	Salmonella_virus	4.2e-09	38.1
AUZ66616.1\|4138256_4138835_-	DNA-invertase	K7PJT4	Enterobacteria_phage	8.3e-74	72.0
AUZ66617.1\|4139335_4139710_+\|tail	tail fiber assembly protein	S5FXM8	Shigella_phage	5.3e-13	51.2
AUZ66618.1\|4139681_4140113_-\|tail	tail fiber assembly protein	M1SNQ2	Escherichia_phage	1.3e-23	43.4
AUZ66619.1\|4140114_4140873_-	hypothetical protein	A0A0C4UQS2	Shigella_phage	1.2e-16	45.5
AUZ66620.1\|4140885_4141470_-	hypothetical protein	C9DGQ7	Escherichia_phage	3.8e-34	40.6
AUZ66621.1\|4141460_4142543_-	hypothetical protein	C9DGQ6	Escherichia_phage	2.0e-113	57.1
AUZ66622.1\|4142544_4142982_-	hypothetical protein	A0A0C4UR04	Shigella_phage	6.8e-52	68.3
AUZ67841.1\|4142978_4143530_-\|plate	phage baseplate assembly protein V	A0A0C4UQZ3	Shigella_phage	8.5e-60	63.9
AUZ66623.1\|4143565_4144699_-\|plate	baseplate protein	C9DGQ3	Escherichia_phage	2.2e-142	68.2
AUZ66624.1\|4144691_4146119_-	multidrug DMT transporter permease	A0A0C4UR32	Shigella_phage	2.2e-91	45.7
AUZ66625.1\|4146130_4148164_-	hypothetical protein	C9DGQ1	Escherichia_phage	8.7e-126	49.1
AUZ66626.1\|4148293_4148749_-	hypothetical protein	A0A0C4UR03	Shigella_phage	7.3e-41	62.0
AUZ66627.1\|4148758_4149115_-\|tail	phage tail protein	C9DGP8	Escherichia_phage	3.2e-44	72.0
AUZ66628.1\|4149124_4150639_-\|tail	phage tail protein	C9DGP7	Escherichia_phage	3.3e-186	66.3
AUZ66629.1\|4150635_4150887_-	hypothetical protein	A0A0C4UR31	Shigella_phage	6.2e-10	54.5
AUZ66630.1\|4150883_4151417_-	hypothetical protein	A0A0C4UQU7	Shigella_phage	6.5e-73	69.9
AUZ66631.1\|4151416_4151839_-	hypothetical protein	A0A0C4UR02	Shigella_phage	4.2e-43	62.1
AUZ67842.1\|4151838_4152279_-	hypothetical protein	A0A0C4UQZ0	Shigella_phage	3.3e-22	52.4
AUZ66632.1\|4152382_4153303_-\|head	head protein	A0A0C4UQR9	Shigella_phage	3.1e-131	72.5
AUZ67843.1\|4153299_4154415_-\|protease	protease	C9DGP0	Escherichia_phage	4.9e-123	64.2
AUZ66633.1\|4154613_4155072_-	phage virion morphogenesis protein	A0A0C4UR01	Shigella_phage	7.3e-49	62.6
AUZ66634.1\|4155191_4156523_-\|head	phage head morphogenesis protein	C9DGN7	Escherichia_phage	7.3e-182	71.7
AUZ66635.1\|4156506_4158051_-	hypothetical protein	A0A0C4UQR8	Shigella_phage	5.4e-221	74.5
AUZ66636.1\|4158050_4159715_-	hypothetical protein	A0A0C4UR29	Shigella_phage	3.6e-263	81.6
AUZ66637.1\|4159716_4160295_-	hypothetical protein	A0A0C4UQU5	Shigella_phage	2.8e-85	87.0
AUZ66638.1\|4160304_4160592_-	hypothetical protein	A0A0C4UR00	Shigella_phage	3.0e-40	87.4
AUZ66639.1\|4160591_4160888_-	DUF2730 domain-containing protein	C9DGN2	Escherichia_phage	1.6e-33	68.4
AUZ66640.1\|4161058_4161346_-	peptidase	NA	NA	NA	NA
AUZ66641.1\|4161618_4162122_-	lysozyme	C9DGM9	Escherichia_phage	3.5e-68	74.1
AUZ66642.1\|4162236_4162656_-	positive regulator of late transcription	A0A0C4UQZ9	Shigella_phage	2.6e-45	66.7
AUZ66643.1\|4162727_4163162_-	hypothetical protein	NA	NA	NA	NA
AUZ66644.1\|4163272_4163689_+	DUF2513 domain-containing protein	NA	NA	NA	NA
AUZ66645.1\|4163671_4163989_-	hypothetical protein	NA	NA	NA	NA
AUZ66646.1\|4163991_4164498_-	hypothetical protein	A0A0C4UQU3	Shigella_phage	4.5e-31	46.7
AUZ66647.1\|4164487_4164934_-	hypothetical protein	NA	NA	NA	NA
AUZ66648.1\|4164933_4165740_-	hypothetical protein	A0A1W6JPA7	Morganella_phage	1.1e-10	40.0
AUZ66649.1\|4165736_4165985_-	hypothetical protein	NA	NA	NA	NA
AUZ66650.1\|4165981_4166422_-	hypothetical protein	NA	NA	NA	NA
AUZ66651.1\|4166418_4166901_-	hypothetical protein	NA	NA	NA	NA
AUZ66652.1\|4166893_4167160_-	hypothetical protein	NA	NA	NA	NA
AUZ66653.1\|4167243_4167861_-	sulfate transporter	A0A2I7S9B0	Vibrio_phage	4.7e-67	61.0
AUZ66654.1\|4167871_4168114_-	hypothetical protein	NA	NA	NA	NA
AUZ67844.1\|4168123_4168324_-	hypothetical protein	A0A0C4UQY4	Shigella_phage	1.5e-11	51.5
AUZ66655.1\|4168403_4169345_-	DNA transposition protein	A0A0C4UQR3	Shigella_phage	2.2e-55	42.1
AUZ67845.1\|4169410_4171399_-\|transposase	transposase	C9DGL1	Escherichia_phage	1.9e-165	49.4
AUZ66656.1\|4171394_4171640_-	DNA-binding protein	A0A2I7S995	Vibrio_phage	6.7e-09	49.2
AUZ66657.1\|4171791_4172313_+	CI repressor protein	A0A0A7DJB4	Pseudomonas_phage	5.3e-11	37.8
AUZ66658.1\|4172619_4173237_-	hypothetical protein	W6MVL2	Pseudomonas_phage	1.6e-30	38.0

DBSCAN-SWA_11

4202246 : 4289836

104

Enterobacteria_phage(32.2%)

transposase,tRNA,holin,capsid,tail,terminase,portal,protease,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ66690.1\|4202246_4203128_-\|protease	protease HtpX	NA	NA	NA	NA
AUZ66691.1\|4203320_4205369_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	9.8e-85	33.1
AUZ66692.1\|4205388_4206075_-	RNA chaperone ProQ	NA	NA	NA	NA
AUZ66693.1\|4206172_4206670_-	GAF domain-containing protein	NA	NA	NA	NA
AUZ66694.1\|4206800_4208084_+	paraquat-inducible protein A	NA	NA	NA	NA
AUZ66695.1\|4208052_4210686_+	MCE family protein	NA	NA	NA	NA
AUZ66696.1\|4210661_4212203_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
AUZ66697.1\|4212314_4212554_+	DUF1480 domain-containing protein	NA	NA	NA	NA
AUZ66698.1\|4212655_4212847_+	DUF1482 domain-containing protein	NA	NA	NA	NA
AUZ66699.1\|4212847_4213510_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	9.0e-56	49.5
AUZ66700.1\|4213918_4214257_-	DUF2511 domain-containing protein	NA	NA	NA	NA
AUZ66701.1\|4214273_4215146_-	hypothetical protein	NA	NA	NA	NA
AUZ66702.1\|4215148_4215523_-	CopC domain-containing protein YobA	NA	NA	NA	NA
AUZ66703.1\|4215660_4215891_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.9e-14	58.8
AUZ66704.1\|4215999_4216662_+	carbon-nitrogen hydrolase family protein	NA	NA	NA	NA
AUZ66705.1\|4216685_4217348_+	exodeoxyribonuclease X	Q6UAU3	Klebsiella_phage	1.0e-06	39.3
AUZ66706.1\|4217329_4219405_-	oligopeptidase B	NA	NA	NA	NA
AUZ66707.1\|4219493_4220153_-	DUF533 domain-containing protein	NA	NA	NA	NA
AUZ66708.1\|4220247_4220601_-	hypothetical protein	NA	NA	NA	NA
AUZ66709.1\|4220674_4220965_-	damage-inducible protein YebG	NA	NA	NA	NA
AUZ66710.1\|4221025_4222246_-\|transposase	ISL3 family transposase ISKox3	NA	NA	NA	NA
AUZ66711.1\|4222420_4223599_+	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
AUZ66712.1\|4223704_4224346_-	keto-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
AUZ66713.1\|4224381_4226193_-	phosphogluconate dehydratase	NA	NA	NA	NA
AUZ66714.1\|4226425_4227901_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	2.2e-78	37.3
AUZ66715.1\|4228231_4229101_+	transcriptional regulator HexR	NA	NA	NA	NA
AUZ66716.1\|4229348_4230791_+	pyruvate kinase	NA	NA	NA	NA
AUZ66717.1\|4230835_4231807_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
AUZ66718.1\|4231929_4233252_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	5.8e-14	39.1
AUZ66719.1\|4233267_4234227_-	zinc ABC transporter substrate-binding protein	NA	NA	NA	NA
AUZ66720.1\|4234290_4235046_+	zinc ABC transporter ATP-binding protein ZnuC	G3M9Y6	Bacillus_virus	1.1e-17	27.8
AUZ66721.1\|4235042_4235828_+	zinc ABC transporter permease	NA	NA	NA	NA
AUZ66722.1\|4235914_4236925_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.3e-08	25.5
AUZ66723.1\|4236933_4237545_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
AUZ66724.1\|4237622_4238144_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	2.6e-10	35.1
AUZ66725.1\|4238178_4238922_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
AUZ67847.1\|4238950_4239403_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
AUZ66726.1\|4239520_4241293_-\|tRNA	aspartate--tRNA ligase	NA	NA	NA	NA
AUZ66727.1\|4241365_4241653_+	hypothetical protein	NA	NA	NA	NA
AUZ66728.1\|4241558_4242125_+	hydrolase	NA	NA	NA	NA
AUZ66729.1\|4242490_4242730_+	DinI family protein	K7P6H1	Enterobacteria_phage	4.2e-32	87.3
AUZ66730.1\|4242859_4243477_-\|tail	phage tail protein	NA	NA	NA	NA
AUZ66731.1\|4244385_4245342_-	hypothetical protein	I6S634	Salmonella_phage	4.0e-105	61.6
AUZ66732.1\|4245349_4248061_-\|tail	phage tail protein	S4TTF5	Salmonella_phage	0.0e+00	84.3
AUZ66733.1\|4248060_4248459_-	hypothetical protein	S4TR39	Salmonella_phage	8.9e-59	80.3
AUZ66734.1\|4248465_4249050_-	hypothetical protein	S4TND4	Salmonella_phage	7.1e-97	88.7
AUZ66735.1\|4249049_4249643_-	hypothetical protein	S4TSP7	Salmonella_phage	9.7e-102	87.8
AUZ66736.1\|4249657_4252987_-\|tail	phage tail tape measure protein	K7P7L6	Enterobacteria_phage	0.0e+00	69.4
AUZ66737.1\|4253045_4253459_-	hypothetical protein	G8C7Q7	Escherichia_phage	4.2e-35	49.6
AUZ66738.1\|4253513_4253792_-	hypothetical protein	Q9MCS5	Enterobacteria_phage	8.7e-37	87.0
AUZ66739.1\|4253815_4254184_-\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	1.8e-50	76.9
AUZ66740.1\|4254194_4254638_-	hypothetical protein	S4TNM8	Salmonella_phage	2.4e-73	94.6
AUZ66741.1\|4254694_4255042_-	hypothetical protein	K7P7Q9	Enterobacteria_phage	7.2e-57	96.5
AUZ66742.1\|4255038_4255488_-	hypothetical protein	K7PH84	Enterobacterial_phage	7.6e-75	98.0
AUZ66743.1\|4255484_4255823_-\|head,tail	head-tail adaptor protein	A0A2H4JHK5	uncultured_Caudovirales_phage	2.7e-40	73.2
AUZ66744.1\|4255832_4256159_-\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	4.9e-55	96.3
AUZ66745.1\|4256158_4256383_-	hypothetical protein	K7PHI6	Enterobacteria_phage	7.5e-15	84.8
AUZ66746.1\|4256422_4257634_-\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	9.9e-194	87.2
AUZ66747.1\|4257643_4258492_-	peptidase S14	K7PH05	Enterobacteria_phage	5.4e-138	92.1
AUZ66748.1\|4258505_4259810_-\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	2.5e-235	94.0
AUZ66749.1\|4259809_4261546_-\|terminase	terminase large subunit	K7PKT2	Enterobacteria_phage	0.0e+00	100.0
AUZ66750.1\|4261545_4262019_-\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	3.3e-84	97.5
AUZ66751.1\|4262174_4262711_-	hypothetical protein	NA	NA	NA	NA
AUZ66752.1\|4262839_4263196_-	HNH endonuclease	K7PHK9	Enterobacteria_phage	4.4e-49	78.9
AUZ66753.1\|4263195_4263783_-	hypothetical protein	S4TR53	Salmonella_phage	1.1e-89	77.8
AUZ66754.1\|4263767_4265225_-	glycosyltransferase	K7PKP3	Enterobacterial_phage	4.4e-249	85.2
AUZ66755.1\|4265243_4265471_-	hypothetical protein	NA	NA	NA	NA
AUZ66756.1\|4266303_4266639_-	hypothetical protein	S4TTH3	Salmonella_phage	8.0e-45	76.6
AUZ66757.1\|4266715_4267261_+	hypothetical protein	S4TR57	Salmonella_phage	4.7e-95	97.8
AUZ66758.1\|4267308_4267533_-	hypothetical protein	A0A2H4J182	uncultured_Caudovirales_phage	1.1e-18	59.7
AUZ66759.1\|4267581_4267998_-	hypothetical protein	NA	NA	NA	NA
AUZ66760.1\|4268006_4268279_-	hypothetical protein	NA	NA	NA	NA
AUZ66761.1\|4268399_4268852_-	hypothetical protein	H9C186	Pectobacterium_phage	3.7e-53	79.3
AUZ66762.1\|4268870_4269398_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	1.2e-13	54.5
AUZ66763.1\|4269394_4269844_-	lysozyme	A0A0M4R365	Salmonella_phage	3.2e-65	80.5
AUZ66764.1\|4269827_4270151_-\|holin	phage holin, lambda family	G5DA93	Enterobacteria_phage	3.6e-42	84.5
AUZ66765.1\|4270371_4270818_+	hypothetical protein	NA	NA	NA	NA
AUZ66766.1\|4270735_4270993_-	hypothetical protein	Q8HA88	Salmonella_phage	1.9e-30	76.5
AUZ66767.1\|4271148_4271964_-	antitermination protein	A0A1B5FPA5	Escherichia_phage	5.2e-114	73.1
AUZ66768.1\|4271963_4272329_-	RusA family crossover junction endodeoxyribonuclease	G8C7V6	Escherichia_phage	1.8e-37	62.3
AUZ66769.1\|4272315_4273698_-	helicase	Q8W640	Enterobacteria_phage	6.2e-176	69.8
AUZ66770.1\|4273694_4274576_-	AAA family ATPase	Q8W641	Enterobacteria_phage	7.2e-85	65.7
AUZ66771.1\|4274590_4275532_-	helix-turn-helix domain-containing protein	Q8W642	Enterobacteria_phage	9.6e-104	71.2
AUZ66772.1\|4275528_4275825_-	transcriptional regulator	NA	NA	NA	NA
AUZ66773.1\|4275850_4276069_-	hypothetical protein	NA	NA	NA	NA
AUZ66774.1\|4276182_4276890_+	helix-turn-helix transcriptional regulator	Q76H56	Enterobacteria_phage	3.3e-96	74.5
AUZ66775.1\|4277262_4277466_+	hypothetical protein	NA	NA	NA	NA
AUZ66776.1\|4278071_4278272_+	hypothetical protein	NA	NA	NA	NA
AUZ66777.1\|4278261_4278618_+	hypothetical protein	A0A1B5FPB3	Escherichia_phage	1.2e-22	48.7
AUZ66778.1\|4278617_4278872_+	hypothetical protein	A0A286SGR4	Klebsiella_phage	7.4e-27	67.9
AUZ66779.1\|4279061_4279469_+	hypothetical protein	A0A286S1S2	Klebsiella_phage	2.2e-28	52.9
AUZ66780.1\|4279465_4280044_+	hypothetical protein	A0A286S1S7	Klebsiella_phage	6.6e-63	60.5
AUZ66781.1\|4280055_4280886_+	DNA-binding protein	A0A2L1IV39	Escherichia_phage	1.9e-31	67.3
AUZ66782.1\|4280882_4281107_+	hypothetical protein	A0A1B5FPG2	Escherichia_phage	8.6e-19	68.5
AUZ66783.1\|4281207_4281669_+	ATPase	A0A1B5FPC7	Escherichia_phage	1.5e-41	52.4
AUZ66784.1\|4281824_4282061_+	excisionase	Q8W657	Enterobacteria_phage	9.3e-40	93.6
AUZ66785.1\|4282116_4283430_+	DUF3596 domain-containing protein	Q8W658	Enterobacteria_phage	7.3e-227	88.1
AUZ66786.1\|4283408_4284182_+	hypothetical protein	Q859D1	Escherichia_coli_phage	5.5e-57	81.1
AUZ66787.1\|4284233_4284629_+	hypothetical protein	NA	NA	NA	NA
AUZ66788.1\|4284669_4285413_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	2.3e-23	30.4
AUZ66789.1\|4285409_4286378_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
AUZ66790.1\|4286545_4287292_-	copper homeostasis protein CutC	NA	NA	NA	NA
AUZ66791.1\|4287294_4287864_-	VOC family protein	NA	NA	NA	NA
AUZ66792.1\|4288102_4289836_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	6.8e-87	34.1

DBSCAN-SWA_12

4357662 : 4406096

Enterobacteria_phage(25.93%)

integrase,tail,terminase,lysis,coat

attL 4357407:4357428|attR 4406121:4406142

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4357407:4357428	attL	NA	NA	NA	NA
AUZ67852.1\|4357662_4358436_-	phage antirepressor Ant	H6WRU9	Salmonella_phage	3.1e-92	78.5
AUZ66856.1\|4358504_4359218_-	hypothetical protein	H6WRU8	Salmonella_phage	5.1e-41	46.5
AUZ66857.1\|4360014_4360197_+	hypothetical protein	NA	NA	NA	NA
AUZ66858.1\|4360227_4360551_-	hypothetical protein	K7PGV5	Enterobacterial_phage	1.9e-27	57.9
AUZ66859.1\|4360870_4361110_+	virulence protein MsgA	K7PKR6	Enterobacteria_phage	2.0e-34	93.7
AUZ66860.1\|4361239_4361857_-\|tail	phage tail protein	NA	NA	NA	NA
AUZ66861.1\|4362765_4363722_-	hypothetical protein	I6S634	Salmonella_phage	4.0e-105	61.6
AUZ66862.1\|4363729_4366441_-\|tail	phage tail protein	S4TTF5	Salmonella_phage	0.0e+00	84.3
AUZ66863.1\|4366440_4366839_-	hypothetical protein	S4TR39	Salmonella_phage	8.9e-59	80.3
AUZ66864.1\|4366845_4367430_-	hypothetical protein	S4TND4	Salmonella_phage	1.2e-96	88.1
AUZ66865.1\|4367429_4368023_-	hypothetical protein	S4TSP7	Salmonella_phage	1.8e-60	58.8
AUZ66866.1\|4368026_4370843_-\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	7.1e-110	35.0
AUZ66867.1\|4371015_4371273_+	hypothetical protein	NA	NA	NA	NA
AUZ66868.1\|4371256_4371481_-	hypothetical protein	NA	NA	NA	NA
AUZ66869.1\|4372002_4372224_-	hypothetical protein	NA	NA	NA	NA
AUZ66870.1\|4372319_4372787_-	hypothetical protein	NA	NA	NA	NA
AUZ66871.1\|4372849_4374010_-	Ig domain-containing protein	A0A059VG08	Pseudomonas_phage	2.8e-60	41.2
AUZ66872.1\|4374036_4374429_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
AUZ66873.1\|4374425_4375058_-	hypothetical protein	A0A059VF88	Pseudomonas_phage	7.6e-12	43.0
AUZ66874.1\|4375050_4375257_-	hypothetical protein	NA	NA	NA	NA
AUZ66875.1\|4375256_4375640_-	glutamate 5-kinase	A0A0S2SYG4	Pseudomonas_phage	1.1e-18	42.9
AUZ66876.1\|4375641_4376034_-	protein singed	A0A0H5AUF0	Pseudomonas_phage	3.2e-13	43.8
AUZ66877.1\|4376037_4376346_-	hypothetical protein	NA	NA	NA	NA
AUZ66878.1\|4376393_4377530_-\|coat	P22 coat - protein 5 family protein	G8C7P7	Escherichia_phage	2.3e-160	75.7
AUZ66879.1\|4377616_4378381_-	hypothetical protein	G8C7P6	Escherichia_phage	6.9e-92	69.3
AUZ66880.1\|4378485_4379598_-	hypothetical protein	I6PD76	Cronobacter_phage	9.0e-117	55.8
AUZ66881.1\|4379584_4380988_-	DUF4055 domain-containing protein	G8C7P4	Escherichia_phage	6.5e-197	73.0
AUZ66882.1\|4380991_4382563_-\|terminase	terminase	G8C7P3	Escherichia_phage	0.0e+00	95.0
AUZ66883.1\|4382559_4383210_-	hypothetical protein	G8C7P2	Escherichia_phage	3.3e-103	90.3
AUZ66884.1\|4383213_4383417_-	hypothetical protein	NA	NA	NA	NA
AUZ66885.1\|4383525_4383990_-\|lysis	lysis protein	A0A0K2FJD0	Enterobacteria_phage	3.3e-41	61.8
AUZ66886.1\|4383986_4384481_-	lysozyme	A0A2H4FND7	Salmonella_phage	7.8e-73	80.2
AUZ66887.1\|4384452_4384656_-	hypothetical protein	O80287	Bacteriophage	1.9e-25	77.6
AUZ66888.1\|4385223_4385907_-	DUF1133 domain-containing protein	Q8HA89	Salmonella_phage	2.3e-38	42.2
AUZ66889.1\|4385903_4386491_-	protein NinG	A0A1P8DTE0	Proteus_phage	1.6e-48	50.3
AUZ66890.1\|4386483_4387152_-	serine/threonine protein phosphatase	K7P6H8	Enterobacteria_phage	1.0e-123	93.2
AUZ66891.1\|4387148_4387319_-	hypothetical protein	K7P7K0	Enterobacteria_phage	1.3e-11	60.7
AUZ66892.1\|4387311_4387761_-	recombination protein NinB	Q8VNP6	Enterobacteria_phage	1.8e-36	51.4
AUZ66893.1\|4388127_4388385_-	DNA polymerase III subunit theta	G8C7V1	Escherichia_phage	1.1e-25	73.8
AUZ66894.1\|4388394_4388595_-	hypothetical protein	NA	NA	NA	NA
AUZ66895.1\|4389012_4389297_-	hypothetical protein	C6ZR26	Salmonella_phage	2.1e-09	78.0
AUZ66896.1\|4390116_4390347_-	hypothetical protein	NA	NA	NA	NA
AUZ66897.1\|4390346_4390751_-	hypothetical protein	F1C5B5	Cronobacter_phage	3.5e-18	59.2
AUZ66898.1\|4390747_4390993_-	hypothetical protein	NA	NA	NA	NA
AUZ66899.1\|4391498_4391909_-	hypothetical protein	NA	NA	NA	NA
AUZ66900.1\|4391910_4392600_-	phage replication protein	G8C7U6	Escherichia_phage	7.0e-120	91.3
AUZ66901.1\|4392596_4393562_-	replication protein	K7PGZ0	Enterobacteria_phage	1.3e-71	91.3
AUZ66902.1\|4393745_4394288_-	regulator	M9NZI6	Enterobacteria_phage	3.6e-87	91.1
AUZ66903.1\|4394305_4394539_-	transcriptional regulator	A0A0P0ZDD7	Stx2-converting_phage	2.6e-18	62.3
AUZ67853.1\|4394580_4395333_+	LexA family transcriptional repressor	A0A286S2B2	Klebsiella_phage	1.6e-72	64.0
AUZ67854.1\|4395775_4396048_+	hypothetical protein	A0A2I7RQ39	Vibrio_phage	6.5e-13	47.0
AUZ66904.1\|4396199_4397165_+	hypothetical protein	Q5G8T6	Enterobacteria_phage	5.3e-65	79.7
AUZ66905.1\|4397157_4397346_+	hypothetical protein	G8C7T3	Escherichia_phage	3.8e-20	94.0
AUZ66906.1\|4397320_4397524_+	cell division inhibitor protein	K7PM31	Enterobacteria_phage	9.5e-25	80.9
AUZ66907.1\|4397594_4398566_+	hypothetical protein	M9P0E1	Enterobacteria_phage	6.3e-66	81.4
AUZ66908.1\|4398573_4398858_+	hypothetical protein	G8C7T1	Escherichia_phage	7.7e-49	95.7
AUZ66909.1\|4398876_4399722_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	6.9e-69	60.7
AUZ66910.1\|4399718_4400399_+	exonuclease	M9NZE1	Enterobacteria_phage	4.2e-125	93.8
AUZ66911.1\|4400859_4401411_+	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	9.1e-54	57.1
AUZ66912.1\|4401407_4401902_+	hypothetical protein	A0A291AXJ6	Shigella_phage	3.1e-29	48.4
AUZ66913.1\|4401898_4402117_+	hypothetical protein	NA	NA	NA	NA
AUZ66914.1\|4402113_4402410_+	nucleoside 2-deoxyribosyltransferase	A0A0U2SAZ1	Escherichia_phage	1.1e-29	67.7
AUZ66915.1\|4402406_4402598_+	hypothetical protein	A0A0P0ZC60	Stx2-converting_phage	2.1e-13	64.4
AUZ66916.1\|4402689_4402962_+	hypothetical protein	NA	NA	NA	NA
AUZ66917.1\|4402964_4403183_+	hypothetical protein	M1FQT7	Enterobacteria_phage	7.8e-17	61.4
AUZ66918.1\|4403179_4403851_+	hypothetical protein	R9VWB9	Serratia_phage	4.5e-31	38.5
AUZ66919.1\|4403828_4404068_+	DUF4222 domain-containing protein	M1FPC8	Enterobacteria_phage	8.3e-28	73.1
AUZ66920.1\|4404077_4404404_+	DUF550 domain-containing protein	K7PGV7	Enterobacterial_phage	3.3e-43	80.0
AUZ66921.1\|4404509_4404755_+	excisionase	Q8W657	Enterobacteria_phage	9.4e-27	67.9
AUZ66922.1\|4404800_4406096_+\|integrase	integrase	Q20GI2	Phage_258-320	1.0e-180	69.1
4406121:4406142	attR	NA	NA	NA	NA

DBSCAN-SWA_13

4610584 : 4619007

Enterobacteria_phage(66.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ67104.1\|4610584_4612618_+\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	1.4e-54	27.6
AUZ67105.1\|4612821_4613280_+	DUF1307 domain-containing protein	Q9EYF5	Enterobacteria_phage	1.1e-49	66.7
AUZ67865.1\|4613324_4613795_-	DUF1456 domain-containing protein	Q9EYF4	Enterobacteria_phage	3.1e-63	76.8
AUZ67106.1\|4613841_4614561_-	two-component system response regulator YehT	NA	NA	NA	NA
AUZ67107.1\|4614553_4616242_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	2.4e-278	91.5
AUZ67108.1\|4616465_4617197_+	HTH-type transcriptional regulator MlrA	Q9EYF2	Enterobacteria_phage	8.3e-103	89.9
AUZ67109.1\|4617256_4617364_+	hypothetical protein	NA	NA	NA	NA
AUZ67110.1\|4617344_4618076_-	ABC transporter permease	NA	NA	NA	NA
AUZ67111.1\|4618059_4619007_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	1.7e-07	26.1

DBSCAN-SWA_14

4821378 : 4904914

101

Shigella_phage(32.73%)

tRNA,holin,integrase,capsid,tail,terminase,portal,plate,protease,head

attL 4865123:4865143|attR 4905110:4905130

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ67283.1\|4821378_4822191_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
AUZ67284.1\|4822190_4823204_-	aspartate-semialdehyde dehydrogenase	NA	NA	NA	NA
AUZ67285.1\|4823270_4824407_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	4.0e-19	27.9
AUZ67878.1\|4824510_4825512_+	flagella biosynthesis regulator Flk	NA	NA	NA	NA
AUZ67286.1\|4825508_4826687_-	arabinose transporter	NA	NA	NA	NA
AUZ67287.1\|4826863_4827238_-	hypothetical protein	NA	NA	NA	NA
AUZ67288.1\|4827408_4827660_+	transcriptional regulator	A0A0M4UV99	Ralstonia_phage	2.1e-13	55.4
AUZ67289.1\|4827818_4828184_+	hypothetical protein	D5GW25	Campylobacter_virus	1.9e-07	35.0
AUZ67290.1\|4828186_4828717_+	DUF3828 domain-containing protein	NA	NA	NA	NA
AUZ67291.1\|4828757_4829975_-	beta-ketoacyl-[acyl-carrier-protein] synthase I	NA	NA	NA	NA
AUZ67292.1\|4830133_4832134_+\|tRNA	bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC	NA	NA	NA	NA
AUZ67293.1\|4832290_4834741_-	hypothetical protein	NA	NA	NA	NA
AUZ67294.1\|4834954_4835314_-	hypothetical protein	NA	NA	NA	NA
AUZ67295.1\|4835354_4835882_-	GTP-binding protein	NA	NA	NA	NA
AUZ67296.1\|4836223_4836880_-	lytic transglycosylase	NA	NA	NA	NA
AUZ67297.1\|4836945_4838667_-	hypothetical protein	NA	NA	NA	NA
AUZ67298.1\|4838708_4839395_-	hypothetical protein	NA	NA	NA	NA
AUZ67299.1\|4839603_4840116_-	hypothetical protein	NA	NA	NA	NA
AUZ67300.1\|4840117_4840552_-	hypothetical protein	NA	NA	NA	NA
AUZ67301.1\|4840600_4841095_-	hypothetical protein	NA	NA	NA	NA
AUZ67302.1\|4841113_4841623_-	hypothetical protein	NA	NA	NA	NA
AUZ67303.1\|4841724_4842087_-	hypothetical protein	NA	NA	NA	NA
AUZ67304.1\|4842221_4843502_-	hypothetical protein	NA	NA	NA	NA
AUZ67305.1\|4843495_4844353_-	hypothetical protein	NA	NA	NA	NA
AUZ67306.1\|4844354_4845269_-	hypothetical protein	NA	NA	NA	NA
AUZ67307.1\|4845265_4846555_-	CpaF family protein	NA	NA	NA	NA
AUZ67308.1\|4846615_4847761_-	hypothetical protein	NA	NA	NA	NA
AUZ67309.1\|4847776_4849192_-	tight adherence secretin RcpA	NA	NA	NA	NA
AUZ67310.1\|4849239_4850184_-	hypothetical protein	NA	NA	NA	NA
AUZ67311.1\|4850521_4850752_-	Flp family type IVb pilin	NA	NA	NA	NA
AUZ67312.1\|4851189_4851474_-	YfcL family protein	NA	NA	NA	NA
AUZ67313.1\|4851505_4852054_-	elongation factor P hydroxylase	NA	NA	NA	NA
AUZ67314.1\|4852053_4852863_-	hypothetical protein	NA	NA	NA	NA
AUZ67315.1\|4852862_4853687_-	penicillin-insensitive murein endopeptidase	NA	NA	NA	NA
AUZ67316.1\|4853690_4854776_-	chorismate synthase	A0A291AU41	Pandoravirus	5.3e-90	47.8
AUZ67317.1\|4854802_4855735_-	50S ribosomal protein L3 N(5)-glutamine methyltransferase	NA	NA	NA	NA
AUZ67318.1\|4855903_4856455_+	endonuclease SmrB	NA	NA	NA	NA
AUZ67319.1\|4856671_4857157_-	phosphohistidine phosphatase SixA	NA	NA	NA	NA
AUZ67320.1\|4857349_4859509_-	fatty acid oxidation complex subunit alpha FadJ	NA	NA	NA	NA
AUZ67321.1\|4859508_4860819_-	acetyl-CoA C-acyltransferase FadI	NA	NA	NA	NA
AUZ67322.1\|4860999_4861284_-	DUF406 domain-containing protein	NA	NA	NA	NA
AUZ67323.1\|4861657_4862998_+	long-chain fatty acid transporter FadL	NA	NA	NA	NA
AUZ67324.1\|4863059_4863815_-	phospholipid-binding lipoprotein MlaA	NA	NA	NA	NA
AUZ67879.1\|4864105_4865047_+	hypothetical protein	E7DYY8	Enterobacteria_phage	1.9e-152	90.2
4865123:4865143	attL	NA	NA	NA	NA
AUZ67325.1\|4865239_4865629_-	DNA polymerase V	K7P6F7	Enterobacteria_phage	2.4e-48	71.9
AUZ67326.1\|4865711_4865951_+	DinI family protein	K7P6H1	Enterobacteria_phage	7.2e-32	87.3
AUZ67327.1\|4866075_4866630_-	DNA-invertase	A0A0F7LA37	Escherichia_phage	6.5e-76	77.3
AUZ67328.1\|4866712_4867060_+	hypothetical protein	F1BUP1	Erwinia_phage	9.2e-12	44.9
AUZ67329.1\|4867061_4867493_+\|tail	tail fiber assembly protein	M1SNQ2	Escherichia_phage	1.3e-23	43.4
AUZ67330.1\|4867464_4867839_-\|tail	tail fiber assembly protein	S5FXM8	Shigella_phage	5.3e-13	51.2
AUZ67331.1\|4868529_4869114_-	hypothetical protein	O22003	Shigella_phage	3.3e-94	80.9
AUZ67332.1\|4869104_4870163_-\|plate	phage baseplate protein	M1FQW3	Enterobacteria_phage	6.9e-159	76.6
AUZ67333.1\|4870149_4870578_-\|tail	phage tail protein	S5FNR6	Shigella_phage	1.1e-65	81.7
AUZ67334.1\|4870574_4871123_-\|plate	baseplate assembly protein	U5P081	Shigella_phage	4.0e-70	71.1
AUZ67335.1\|4871122_4872202_-\|plate	baseplate protein	U5P0H6	Shigella_phage	8.9e-170	80.5
AUZ67336.1\|4872198_4873500_-	DNA circularization protein	S5FUX4	Shigella_phage	4.2e-182	72.4
AUZ67337.1\|4873592_4874030_+	hypothetical protein	NA	NA	NA	NA
AUZ67338.1\|4874044_4875835_-\|tail	phage tail tape measure protein	Q8SBG9	Shigella_phage	5.3e-244	80.5
AUZ67339.1\|4875827_4876010_-	hypothetical protein	NA	NA	NA	NA
AUZ67340.1\|4875976_4876246_-\|tail	phage tail assembly protein	M1FPE4	Enterobacteria_phage	2.4e-36	83.0
AUZ67341.1\|4876245_4876602_-\|tail	phage tail protein	U5P076	Shigella_phage	1.8e-58	90.7
AUZ67342.1\|4876601_4878098_-\|tail	phage tail protein	M1FN90	Enterobacteria_phage	3.3e-239	85.5
AUZ67343.1\|4878087_4878252_-	DUF2635 domain-containing protein	Q8SBH3	Shigella_phage	1.8e-21	88.9
AUZ67344.1\|4878260_4878821_-	hypothetical protein	Q8SBH4	Shigella_phage	7.5e-88	82.3
AUZ67345.1\|4878820_4879324_-	hypothetical protein	Q8SBH5	Shigella_phage	3.1e-77	85.6
AUZ67346.1\|4879298_4879712_-\|head,tail	head-tail adaptor protein	U5P0R0	Shigella_phage	7.8e-50	71.5
AUZ67347.1\|4879708_4880032_-\|head,tail	phage gp6-like head-tail connector protein	S5FKK6	Shigella_phage	3.2e-35	64.2
AUZ67348.1\|4880106_4881330_-\|capsid	phage major capsid protein	A0A1W6JP20	Morganella_phage	1.8e-163	72.5
AUZ67349.1\|4881339_4881939_-\|head,protease	HK97 family phage prohead protease	Q8SBH9	Shigella_phage	2.3e-90	82.0
AUZ67350.1\|4881931_4883158_-\|portal	phage portal protein	Q8SBI0	Shigella_phage	1.6e-215	88.9
AUZ67351.1\|4883305_4885039_-\|terminase	terminase	Q8HAD6	Salmonella_phage	0.0e+00	93.6
AUZ67352.1\|4885035_4885533_-\|terminase	phage terminase small subunit P27 family	Q8HAD7	Salmonella_phage	1.9e-82	92.7
AUZ67880.1\|4885658_4886009_-	HNH endonuclease	M1FQV2	Enterobacteria_phage	3.5e-51	80.2
AUZ67353.1\|4886073_4886598_-	Rha family transcriptional regulator	G8C7W4	Escherichia_phage	1.8e-88	95.4
AUZ67354.1\|4886620_4886806_+	hypothetical protein	H6WRZ7	Salmonella_phage	6.0e-18	92.0
AUZ67355.1\|4886757_4887288_-	DUF2514 domain-containing protein	A0A291LBG9	Klebsiella_phage	9.5e-08	48.5
AUZ67356.1\|4887284_4887734_-	muraminidase	A0A0M4R365	Salmonella_phage	9.3e-65	79.9
AUZ67357.1\|4887717_4888041_-\|holin	phage holin, lambda family	Q5G8R5	Enterobacteria_phage	6.1e-42	83.8
AUZ67358.1\|4888195_4889101_-\|protease	serine protease	NA	NA	NA	NA
AUZ67359.1\|4889745_4890504_-	antitermination protein	K7PGU5	Enterobacteria_phage	2.2e-82	63.5
AUZ67881.1\|4890517_4891507_-	hypothetical protein	A0A291AWV9	Escherichia_phage	1.9e-150	73.6
AUZ67360.1\|4891503_4891782_-	hypothetical protein	NA	NA	NA	NA
AUZ67882.1\|4891774_4892650_-	hypothetical protein	F1C5A3	Cronobacter_phage	1.1e-61	46.1
AUZ67361.1\|4892753_4893140_-	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	4.0e-56	84.0
AUZ67362.1\|4893136_4893484_-	LexA family transcriptional regulator	S5FXP5	Shigella_phage	5.4e-20	47.2
AUZ67363.1\|4893453_4895319_-	DNA cytosine methyltransferase	H9C171	Pectobacterium_phage	1.0e-210	57.8
AUZ67364.1\|4895311_4896190_-	phage N-6-adenine-methyltransferase	Q8HA94	Salmonella_phage	2.4e-149	86.0
AUZ67365.1\|4896189_4897122_-	hypothetical protein	K7PLZ7	Enterobacterial_phage	6.2e-79	50.8
AUZ67366.1\|4897105_4897291_-	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	9.5e-16	73.1
AUZ67367.1\|4897454_4898009_-	hypothetical protein	Q8SBF4	Shigella_phage	5.7e-48	54.6
AUZ67368.1\|4898053_4898248_-	cell division protein	NA	NA	NA	NA
AUZ67369.1\|4898349_4898976_+	LexA family transcriptional repressor	K7PM82	Enterobacteria_phage	1.4e-45	47.8
AUZ67884.1\|4899187_4899406_+	hypothetical protein	NA	NA	NA	NA
AUZ67883.1\|4899380_4899614_-	hypothetical protein	NA	NA	NA	NA
AUZ67370.1\|4899989_4900172_+	hypothetical protein	U5P4J6	Shigella_phage	7.4e-13	88.6
AUZ67371.1\|4900263_4900803_+	hypothetical protein	A0A192Y8M4	Salmonella_phage	4.4e-85	86.6
AUZ67372.1\|4900963_4901218_+	hypothetical protein	A0A0A7NV47	Enterobacteria_phage	6.3e-10	40.0
AUZ67373.1\|4901214_4901943_+	site-specific DNA-methyltransferase	A0A0H5BBV5	Pseudomonas_phage	1.0e-84	64.8
AUZ67374.1\|4902994_4903555_+	3'-5' exoribonuclease	K7PLW7	Enterobacteria_phage	5.7e-88	81.1
AUZ67375.1\|4903575_4903761_+	hypothetical protein	A0A2R2Z2X2	Escherichia_phage	6.2e-15	61.4
AUZ67376.1\|4903744_4904914_-\|integrase	integrase	A0A2R2Z2Y0	Escherichia_phage	1.1e-194	82.8
4905110:4905130	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. CP026211

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

25988 : 31156

Escherichia_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62497.1\|25988_26546_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	3.4e-48	81.3
AUZ62498.1\|26630_27335_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.6e-138	99.6
AUZ62499.1\|27368_27503_-	ABC transporter	NA	NA	NA	NA
AUZ62500.1\|27655_28156_-	ferritin	NA	NA	NA	NA
AUZ62501.1\|28482_29187_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	2.6e-138	99.6
AUZ62502.1\|29306_30287_-\|transposase	IS5-like element ISKpn26 family transposase	A0A077SK28	Escherichia_phage	6.8e-185	98.8
AUZ62503.1\|30564_30846_-	XRE family transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
AUZ62504.1\|30826_31156_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. CP026212

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 98534

113

Escherichia_phage(13.04%)

integrase,protease,transposase

attL 18424:18439|attR 81264:81279

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62529.1\|1493_3803_-	type IV conjugative transfer system coupling protein TraD	NA	NA	NA	NA
AUZ62661.1\|3928_4315_-	hypothetical protein	NA	NA	NA	NA
AUZ62530.1\|4811_5345_-	hypothetical protein	NA	NA	NA	NA
AUZ62662.1\|5355_8025_-	conjugal transfer protein TraG	NA	NA	NA	NA
AUZ62531.1\|8312_9389_+\|transposase	IS110 family transposase	NA	NA	NA	NA
AUZ62532.1\|9602_10973_-	conjugal transfer protein TraH	NA	NA	NA	NA
AUZ62533.1\|10959_11388_-	conjugal transfer protein TrbF	NA	NA	NA	NA
AUZ62534.1\|11380_11953_-	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	NA	NA	NA	NA
AUZ62535.1\|11924_12164_-	conjugal transfer protein TraQ	NA	NA	NA	NA
AUZ62536.1\|12174_12927_-	type-F conjugative transfer system pilin assembly protein TraF	NA	NA	NA	NA
AUZ62537.1\|12947_13274_-	hypothetical protein	NA	NA	NA	NA
AUZ62538.1\|13286_13535_-	hypothetical protein	NA	NA	NA	NA
AUZ62539.1\|13512_13767_-	conjugal transfer protein TrbE	NA	NA	NA	NA
AUZ62540.1\|13798_15754_-	conjugal transfer protein TraN	NA	NA	NA	NA
AUZ62541.1\|15812_16460_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
AUZ62542.1\|16603_17206_-	hypothetical protein	NA	NA	NA	NA
AUZ62543.1\|17262_17952_+	hypothetical protein	NA	NA	NA	NA
AUZ62544.1\|17926_18475_-	hypothetical protein	NA	NA	NA	NA
18424:18439	attL	NA	NA	NA	NA
AUZ62545.1\|18489_19482_-	conjugal transfer protein TraU	NA	NA	NA	NA
AUZ62546.1\|19492_20119_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
AUZ62547.1\|20118_20511_-	type-F conjugative transfer system protein TrbI	NA	NA	NA	NA
AUZ62548.1\|20507_23147_-	type IV secretion system protein TraC	NA	NA	NA	NA
AUZ62549.1\|23218_23611_-	hypothetical protein	NA	NA	NA	NA
AUZ62550.1\|23624_23915_-	hypothetical protein	NA	NA	NA	NA
AUZ62551.1\|23911_24316_-	hypothetical protein	NA	NA	NA	NA
AUZ62552.1\|24382_24694_-	hypothetical protein	NA	NA	NA	NA
AUZ62553.1\|24694_24913_-	hypothetical protein	NA	NA	NA	NA
AUZ62663.1\|24936_25221_-	hypothetical protein	NA	NA	NA	NA
AUZ62554.1\|25225_25636_-	hypothetical protein	NA	NA	NA	NA
AUZ62555.1\|25767_26337_-	type IV conjugative transfer system protein TraV	NA	NA	NA	NA
AUZ62556.1\|26359_26956_-	conjugal transfer protein TraP	NA	NA	NA	NA
AUZ62557.1\|26948_28373_-	conjugal transfer protein TraB	NA	NA	NA	NA
AUZ62558.1\|28372_29113_-	type-F conjugative transfer system secretin TraK	NA	NA	NA	NA
AUZ62559.1\|29099_29666_-	type IV conjugative transfer system protein TraE	NA	NA	NA	NA
AUZ62560.1\|29685_29991_-	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
AUZ62561.1\|30004_30373_-	type IV conjugative transfer system pilin TraA	NA	NA	NA	NA
AUZ62562.1\|30422_30605_-	TraY domain-containing protein	NA	NA	NA	NA
AUZ62563.1\|30790_31465_-	hypothetical protein	NA	NA	NA	NA
AUZ62564.1\|31703_32093_-	conjugal transfer protein TraM	NA	NA	NA	NA
AUZ62565.1\|32525_33011_+	lytic transglycosylase	NA	NA	NA	NA
AUZ62566.1\|33043_33373_-	hypothetical protein	NA	NA	NA	NA
AUZ62567.1\|33405_34227_-	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.2e-44	40.1
AUZ62568.1\|35046_35880_-	SAM-dependent DNA methyltransferase	A0A2K9V411	Faecalibacterium_phage	1.8e-21	33.5
AUZ62569.1\|35930_36077_-	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
AUZ62570.1\|36171_36519_-	hypothetical protein	NA	NA	NA	NA
AUZ62571.1\|36575_36929_-	hypothetical protein	A0A248SL90	Klebsiella_phage	5.0e-29	64.2
AUZ62572.1\|36930_37050_-	single-stranded DNA-binding protein	NA	NA	NA	NA
AUZ62573.1\|37558_37909_-	hypothetical protein	NA	NA	NA	NA
AUZ62574.1\|37905_38178_-	hypothetical protein	NA	NA	NA	NA
AUZ62575.1\|38225_38585_-	hypothetical protein	NA	NA	NA	NA
AUZ62576.1\|38695_39019_-	theronine dehydrogenase	I3UM57	Rhodobacter_phage	2.3e-09	34.2
AUZ62577.1\|39022_39745_-	plasmid SOS inhibition protein A	NA	NA	NA	NA
AUZ62578.1\|39741_40173_-	conjugation system SOS inhibitor PsiB	NA	NA	NA	NA
AUZ62579.1\|40218_42228_-	hypothetical protein	G8DH78	Emiliania_huxleyi_virus	1.5e-24	27.4
AUZ62580.1\|42296_42539_-	DUF905 domain-containing protein	NA	NA	NA	NA
AUZ62581.1\|42586_43099_-	single-stranded DNA-binding protein	A0A0A0P1Q9	Enterobacteria_phage	8.5e-54	84.7
AUZ62582.1\|43838_44156_-	hypothetical protein	NA	NA	NA	NA
AUZ62583.1\|44190_44451_-	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	2.0e-11	48.7
AUZ62584.1\|44632_44824_-	hypothetical protein	NA	NA	NA	NA
AUZ62585.1\|44866_45373_-	antirestriction protein	G9FHQ1	Rhodococcus_virus	7.7e-07	31.1
AUZ62586.1\|45415_45844_-	antirestriction protein	NA	NA	NA	NA
AUZ62587.1\|46524_47292_-	hypothetical protein	NA	NA	NA	NA
AUZ62588.1\|47345_47765_-	DUF1380 domain-containing protein	NA	NA	NA	NA
AUZ62589.1\|47774_47996_-	hypothetical protein	NA	NA	NA	NA
AUZ62590.1\|47995_48697_-	DNA methylase	A0A2I7RE86	Vibrio_phage	3.2e-27	36.7
AUZ62591.1\|49133_49364_-	hypothetical protein	NA	NA	NA	NA
AUZ62592.1\|49427_50099_-	Mediator of plasmid stability	NA	NA	NA	NA
AUZ62593.1\|50101_51073_-	StbA family protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
AUZ62594.1\|51306_51738_+	peptidase	A0A1W6JNS2	Morganella_phage	2.1e-29	53.3
AUZ62595.1\|51737_53009_+	translesion error-prone DNA polymerase V subunit UmuC	F1C5A5	Cronobacter_phage	5.2e-153	64.0
AUZ62596.1\|53420_54296_+	replication initiation protein	Q71TL8	Escherichia_phage	5.6e-82	56.4
AUZ62597.1\|54928_55555_+	cobyrinic acid ac-diamide synthase	A0A222YXS3	Escherichia_phage	2.9e-40	43.6
AUZ62664.1\|55674_55854_+	Par-like protein	NA	NA	NA	NA
AUZ62598.1\|56357_57152_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.5e-52	88.7
AUZ62599.1\|57349_58366_-	hypothetical protein	NA	NA	NA	NA
AUZ62600.1\|58376_58691_-	hypothetical protein	NA	NA	NA	NA
AUZ62665.1\|58717_59077_-	hypothetical protein	NA	NA	NA	NA
AUZ62601.1\|59281_59587_-	plasmid maintenance protein CcdB	NA	NA	NA	NA
AUZ62602.1\|59588_59807_-	plasmid maintenance protein CcdA	NA	NA	NA	NA
AUZ62603.1\|59858_60086_+	hypothetical protein	NA	NA	NA	NA
AUZ62666.1\|59976_60351_-	hypothetical protein	NA	NA	NA	NA
AUZ62604.1\|60403_60634_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AUZ62605.1\|60630_61047_+	PIN domain-containing protein	NA	NA	NA	NA
AUZ62606.1\|61087_61966_-	DUF3644 domain-containing protein	NA	NA	NA	NA
AUZ62607.1\|62627_63905_+	colicin V secretion protein CvaA	NA	NA	NA	NA
AUZ62608.1\|63894_66003_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	3.2e-38	27.1
AUZ62609.1\|66002_66638_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
AUZ62610.1\|66745_67087_-	hypothetical protein	NA	NA	NA	NA
AUZ62611.1\|68536_68977_-	hypothetical protein	NA	NA	NA	NA
AUZ62667.1\|68995_69589_-	hypothetical protein	NA	NA	NA	NA
AUZ62612.1\|69880_70111_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
AUZ62613.1\|70107_70524_+	PIN domain nuclease	NA	NA	NA	NA
AUZ62614.1\|70597_72157_+	ATP-dependent endonuclease	NA	NA	NA	NA
AUZ62615.1\|72198_73167_-\|transposase	IS5/IS1182 family transposase	A0A1B0VFY5	Salmonella_phage	8.8e-177	94.1
AUZ62616.1\|73210_74233_+	DNA helicase UvrD	NA	NA	NA	NA
AUZ62668.1\|74776_75685_+	HNH endonuclease	NA	NA	NA	NA
AUZ62617.1\|75870_76221_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	6.0e-19	51.4
AUZ62618.1\|76368_76800_-	silver-binding protein SilE	NA	NA	NA	NA
AUZ62619.1\|77386_78355_-\|transposase	IS5-like element IS903B family transposase	A0A1B0VFY5	Salmonella_phage	1.0e-185	99.1
AUZ62620.1\|78727_80920_+	1,4-alpha-glucan branching enzyme	NA	NA	NA	NA
AUZ62621.1\|81049_82333_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
81264:81279	attR	NA	NA	NA	NA
AUZ62622.1\|82421_83855_+	glycogen synthase GlgA	NA	NA	NA	NA
AUZ62623.1\|83873_86321_+	glycogen phosphorylase	A0A140XAG6	Dickeya_phage	6.1e-25	69.2
AUZ62624.1\|86434_88078_+	alpha-D-glucose phosphate-specific phosphoglucomutase	A0A1X9I671	Streptococcus_phage	1.5e-22	25.0
AUZ62625.1\|88202_88769_+	LuxR family transcriptional regulator	NA	NA	NA	NA
AUZ62626.1\|89103_89382_+	hypothetical protein	NA	NA	NA	NA
AUZ62627.1\|89621_91019_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUZ62628.1\|91129_92662_+\|transposase	IS3-like element ISKpn38 family transposase	A0A1B1P773	Bacillus_phage	4.1e-51	39.8
AUZ62629.1\|92809_93205_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
AUZ62669.1\|93253_94600_-\|transposase	transposase	NA	NA	NA	NA
AUZ62670.1\|94825_95458_+	hypothetical protein	NA	NA	NA	NA
AUZ62630.1\|95486_96890_-\|transposase	ISNCY family transposase ISKpn21	NA	NA	NA	NA
AUZ62631.1\|97001_98534_+\|transposase	IS3-like element ISKpn38 family transposase	A0A1B1P773	Bacillus_phage	4.1e-51	39.8

DBSCAN-SWA_2

102820 : 107129

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62639.1\|102820_103171_+	transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	1.1e-23	50.9
AUZ62640.1\|103222_103585_+	arsenical resistance operon transcriptional repressor ArsD	NA	NA	NA	NA
AUZ62641.1\|103602_105354_+	arsenical pump-driving ATPase	NA	NA	NA	NA
AUZ62642.1\|105401_106691_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	3.3e-171	73.8
AUZ62643.1\|106703_107129_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	6.6e-52	72.1

DBSCAN-SWA_3

110646 : 112170

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62647.1\|110646_112170_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.7e-44	31.8

DBSCAN-SWA_4

118498 : 123096

Wolbachia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62672.1\|118498_119050_-	endonuclease	A0A1B2LRT6	Wolbachia_phage	1.8e-17	31.7
AUZ62655.1\|119153_119462_-	hypothetical protein	K7PKY8	Enterobacterial_phage	1.7e-17	40.4
AUZ62656.1\|119458_120109_-	DUF2726 domain-containing protein	NA	NA	NA	NA
AUZ62657.1\|120164_120809_-	hypothetical protein	NA	NA	NA	NA
AUZ62658.1\|120858_121455_-	hypothetical protein	NA	NA	NA	NA
AUZ62659.1\|121621_122215_-	conjugal transfer protein	NA	NA	NA	NA
AUZ62660.1\|122370_123096_-	type-F conjugative transfer system pilin acetylase TraX	A0A1D6ZIU7	Xanthomonas_phage	1.2e-05	28.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. CP026213

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

142860 : 160637

Escherichia_phage(40.0%)

integrase,transposase

attL 143462:143521|attR 156894:157714

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62918.1\|142860_143475_-	hypothetical protein	A0A076G6Q2	Escherichia_phage	1.9e-60	52.5
143462:143521	attL	NA	NA	NA	NA
AUZ62824.1\|143525_144230_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ62825.1\|144451_144766_-\|transposase	transposase	NA	NA	NA	NA
AUZ62826.1\|144704_145718_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
AUZ62827.1\|145864_146347_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	6.6e-16	28.9
AUZ62828.1\|146567_146834_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
AUZ62829.1\|146976_147741_+\|transposase	IS6 family transposase IS6100	A0A077SL39	Escherichia_phage	4.3e-86	65.7
AUZ62830.1\|147782_147995_+	resolvase	NA	NA	NA	NA
AUZ62831.1\|148007_149216_+	restriction endonuclease	E5E3X4	Burkholderia_phage	2.1e-34	42.5
AUZ62832.1\|149249_150683_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
AUZ62833.1\|151064_151271_-	hypothetical protein	NA	NA	NA	NA
AUZ62919.1\|151275_151764_-	restriction endonuclease	NA	NA	NA	NA
AUZ62834.1\|151972_152284_-	hypothetical protein	NA	NA	NA	NA
AUZ62835.1\|152319_152634_-	IncN plasmid KikA protein	NA	NA	NA	NA
AUZ62836.1\|152630_152975_-	hypothetical protein	NA	NA	NA	NA
AUZ62920.1\|152990_153341_-	KorB	NA	NA	NA	NA
AUZ62837.1\|153404_154139_+	traL protein	NA	NA	NA	NA
AUZ62921.1\|154147_154429_+	transcriptional regulator	NA	NA	NA	NA
AUZ62838.1\|154438_154732_+	conjugal transfer protein TraM	NA	NA	NA	NA
AUZ62839.1\|154781_155099_+	type IV secretion system protein VirB3	NA	NA	NA	NA
AUZ62840.1\|156957_157662_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ62841.1\|158186_159068_+	carbapenem-hydrolyzing class A beta-lactamase KPC-2	A0A1B0VBP7	Salmonella_phage	2.2e-73	52.2
156894:157714	attR	NA	NA	NA	NA
AUZ62842.1\|159317_160637_-\|transposase	IS1182 family transposase ISKpn6	Q9MBP7	Staphylococcus_prophage	1.9e-12	24.2

DBSCAN-SWA_2

171901 : 202879

Salmonella_phage(27.27%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AUZ62852.1\|171901_172606_+\|transposase	IS6 family transposase IS15DIV	A0A077SL39	Escherichia_phage	1.8e-139	100.0
AUZ62853.1\|174502_175507_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
AUZ62854.1\|175688_175865_-	DUF4102 domain-containing protein	T1S9J3	Salmonella_phage	1.0e-06	68.6
AUZ62855.1\|176194_177010_+	sulfonamide-resistant dihydropteroate synthase Sul2	A0A0B5J4J5	Pandoravirus	5.9e-09	27.6
AUZ62856.1\|177070_177874_+	aminoglycoside O-phosphotransferase APH(3'')-Ib	NA	NA	NA	NA
AUZ62857.1\|177873_178710_+	aminoglycoside O-phosphotransferase APH(6)-Id	NA	NA	NA	NA
AUZ62858.1\|179636_180641_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
AUZ62859.1\|180719_183692_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	73.1
AUZ62860.1\|183694_184252_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	5.8e-48	81.3
AUZ62861.1\|184381_184594_-	DUF3330 domain-containing protein	NA	NA	NA	NA
AUZ62922.1\|184556_184676_+	mercury resistance protein	NA	NA	NA	NA
AUZ62862.1\|184659_184896_-	mercury resistance protein	NA	NA	NA	NA
AUZ62863.1\|184892_185258_-	transcriptional regulator	NA	NA	NA	NA
AUZ62864.1\|185275_186958_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-38	27.8
AUZ62865.1\|186996_187404_-	mercury transport protein MerC	NA	NA	NA	NA
AUZ62866.1\|187431_187707_-	mercuric transporter periplasmic component	NA	NA	NA	NA
AUZ62867.1\|187722_188073_-	mercuric transporter	NA	NA	NA	NA
AUZ62868.1\|188144_188600_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
AUZ62869.1\|188964_189255_+	nucleotidyltransferase	NA	NA	NA	NA
AUZ62870.1\|189251_189653_+	hypothetical protein	NA	NA	NA	NA
AUZ62871.1\|189642_189999_+	cupin domain-containing protein	NA	NA	NA	NA
AUZ62872.1\|190253_190568_+	hypothetical protein	NA	NA	NA	NA
AUZ62873.1\|190740_191274_-	phospholipase D family protein	A0A1B2LRT6	Wolbachia_phage	5.8e-21	33.9
AUZ62874.1\|191273_192269_-	conjugal transfer protein TraG	NA	NA	NA	NA
AUZ62875.1\|192310_193471_-	conjugal transfer protein TraF	NA	NA	NA	NA
AUZ62876.1\|193470_194292_-	conjugal transfer protein TraO	NA	NA	NA	NA
AUZ62877.1\|194365_195064_-	type IV secretion system protein VirB8	NA	NA	NA	NA
AUZ62923.1\|195053_195167_-	conjugal transfer protein TraN	NA	NA	NA	NA
AUZ62878.1\|195288_196056_-	DUF1883 domain-containing protein	S6BFN8	Thermus_phage	9.8e-30	46.4
AUZ62879.1\|196224_196839_+	hypothetical protein	NA	NA	NA	NA
AUZ62880.1\|196879_197587_-	hypothetical protein	NA	NA	NA	NA
AUZ62881.1\|197614_198181_-	resolvase/recombinase	Q1MVP4	Enterobacteria_phage	3.5e-77	82.6
AUZ62882.1\|198732_199437_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	4.0e-139	99.6
AUZ62883.1\|199798_201481_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-10	37.4
AUZ62884.1\|201856_202879_-\|transposase	IS110 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. CP026210

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. CP026216

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. CP026211

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. CP026212

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

5. CP026213

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection