CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
CP015128	Lactobacillus plantarum strain CAUH2 plasmid pCAUH202, complete sequence	0 crisprs	RT	0
CP015127	Lactobacillus plantarum strain CAUH2 plasmid pCAUH201, complete sequence	0 crisprs	NA	0
CP015129	Lactobacillus plantarum strain CAUH2 plasmid pCAUH203, complete sequence	0 crisprs	csa3	0
CP015126	Lactobacillus plantarum strain CAUH2, complete genome	1 crisprs	csa3,DinG,cas3,DEDDh	7

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: CP015126_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

CP015126_1

2738260-2738345

Orphan

Consensus_repeat	Method
TAAGAAACTTAAAGTGTCTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of CP015126_1

>merge|CP015126|1|2738260-2738345|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATTCGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAATAAGAAACTTAAAGTATCTTATT

>CP015126|1|1|2738260-2738345|CRISPRCasFinder
TAAGAAACTTAAAGTGTCTTATT	CGCATAACTGGTATAATACGCTATATAAAGAAAAAGTCAA
TAAGAAACTTAAAGTATCTTATT

Protein	Signature genes	Signature genes Name	Protein_function
CP015126.1\|AMX11408.1\|2730741_2731470_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP015126.1\|AMX11418.1\|2742034_2743030_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP015126.1\|AMX11413.1\|2736196_2736436_-\|hypothetical-protein	unknown	unknown	unknown
CP015126.1\|AMX11923.1\|2739082_2739964_-\|ferrichrome-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
CP015126.1\|AMX11922.1\|2735758_2735950_+\|hypothetical-protein	unknown	unknown	unknown
CP015126.1\|AMX11420.1\|2743767_2744661_-\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|187572
CP015126.1\|AMX11407.1\|2730243_2730609_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224647
CP015126.1\|AMX11423.1\|2746482_2747319_+\|short-chain-dehydrogenase	unknown	unknown	gnl\|CDD\|212492
CP015126.1\|AMX11416.1\|2740248_2741043_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
CP015126.1\|AMX11411.1\|2733507_2734074_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226078
CP015126.1\|AMX11406.1\|2729675_2729960_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378097
CP015126.1\|AMX11414.1\|2736766_2738245_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|129794
CP015126.1\|AMX11421.1\|2744954_2745701_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226674
CP015126.1\|AMX11415.1\|2738362_2738962_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP015126.1\|AMX11412.1\|2734293_2735247_-\|aldo/keto-reductase	unknown	unknown	gnl\|CDD\|381318
CP015126.1\|AMX11410.1\|2732321_2733359_+\|epimerase	unknown	unknown	gnl\|CDD\|187538
CP015126.1\|AMX11422.1\|2745717_2746173_-\|acetyltransferase	unknown	unknown	gnl\|CDD\|100047
CP015126.1\|AMX11409.1\|2731628_2732195_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
CP015126.1\|AMX11417.1\|2741039_2742038_+\|ferrichrome-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
CP015126.1\|AMX11419.1\|2743274_2743787_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|274100

Protein	Function_ID	Function_description	E-value
CP015126.1\|AMX11408.1\|2730741_2731470_+\|oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	1.6523e-89
CP015126.1\|AMX11418.1\|2742034_2743030_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.35687e-78
CP015126.1\|AMX11414.1\|2736766_2738245_-\|MFS-transporter	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	1.13969e-71
CP015126.1\|AMX11420.1\|2743767_2744661_-\|short-chain-dehydrogenase	gnl\|CDD\|187572	cd05262, SDR_a7, atypical (a) SDRs, subgroup 7. This subgroup contains atypical SDRs of unknown function. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.70513e-130
CP015126.1\|AMX11407.1\|2730243_2730609_-\|hypothetical-protein	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.16334e-31
CP015126.1\|AMX11423.1\|2746482_2747319_+\|short-chain-dehydrogenase	gnl\|CDD\|212492	cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs. Classical SDR subgroup containing retinol-DHs, LPORs, and related proteins. Retinol is processed by a medium chain alcohol dehydrogenase followed by retinol-DHs. Pchlide reductases act in chlorophyll biosynthesis. There are distinct enzymes that catalyze Pchlide reduction in light or dark conditions. Light-dependent reduction is via an NADP-dependent SDR, LPOR. Proteins in this subfamily share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. This subgroup includes the human proteins: retinol dehydrogenase -12, -13 ,and -14, dehydrogenase/reductase SDR family member (DHRS)-12 , -13 and -X (a DHRS on chromosome X), and WWOX (WW domain-containing oxidoreductase), as well as a Neurospora crassa SDR encoded by the blue light inducible bli-4 gene. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.07613e-56
CP015126.1\|AMX11416.1\|2740248_2741043_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	5.60764e-114
CP015126.1\|AMX11411.1\|2733507_2734074_-\|hypothetical-protein	gnl\|CDD\|226078	COG3548, COG3548, Predicted integral membrane protein [Function unknown].	5.75015e-29
CP015126.1\|AMX11406.1\|2729675_2729960_+\|hypothetical-protein	gnl\|CDD\|378097	pfam08922, DUF1905, Domain of unknown function (DUF1905). This domain is found in a set of hypothetical bacterial proteins.	1.07383e-22
CP015126.1\|AMX11923.1\|2739082_2739964_-\|ferrichrome-ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	3.71721e-55
CP015126.1\|AMX11421.1\|2744954_2745701_-\|oxidoreductase	gnl\|CDD\|226674	COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only].	2.40011e-91
CP015126.1\|AMX11415.1\|2738362_2738962_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.95133e-09
CP015126.1\|AMX11412.1\|2734293_2735247_-\|aldo/keto-reductase	gnl\|CDD\|381318	cd19092, AKR_BsYcsN_EcYdhF-like, Bacillus subtilis YcsN, Escherichia coli YdhF and similar proteins. Bacillus subtilis YcsN and Escherichia coli YdhF are prototypes of this family. They are uncharacterized aldo/keto reductase family oxidoreductases.	5.65843e-131
CP015126.1\|AMX11410.1\|2732321_2733359_+\|epimerase	gnl\|CDD\|187538	cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs. This subgroup contains aldehyde reductase of the extended SDR-type and related proteins. Aldehyde reductase I (aka carbonyl reductase) is an NADP-binding SDR; it has an NADP-binding motif consensus that is slightly different from the canonical SDR form and lacks the Asn of the extended SDR active site tetrad. Aldehyde reductase I catalyzes the NADP-dependent reduction of ethyl 4-chloro-3-oxobutanoate to ethyl (R)-4-chloro-3-hydroxybutanoate. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	7.62333e-95
CP015126.1\|AMX11422.1\|2745717_2746173_-\|acetyltransferase	gnl\|CDD\|100047	cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).	5.688e-52
CP015126.1\|AMX11409.1\|2731628_2732195_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	7.31502e-05
CP015126.1\|AMX11417.1\|2741039_2742038_+\|ferrichrome-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	6.03952e-81
CP015126.1\|AMX11419.1\|2743274_2743787_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|274100	TIGR02366, conserved_hypothetical_protein, probable dihydroxyacetone kinase regulator. The seed alignment for this family was built from a set of closely related uncharacterized proteins associated with operons for the type of bacterial dihydroxyacetone kinase that transfers PEP-derived phosphate from a phosphoprotein, as in phosphotransferase system transport, rather than from ATP. Members have a TetR transcriptional regulator domain (pfam00440) at the N-terminus and sequence homology throughout.	3.33884e-08

>CP015126.1|AMX11414.1|2736766_2738245_-|MFS-transporter
MQAKAKISKATMTIAWVVVFGAMAPLLDSTMINIAINNLVTSFHSSVTTVQWAVTGYLLATGVAVPFSSWLLNRFDGKAVFVAGEILFGLGSIFAAVVPNIQLLIIARLVQGFAGGLIMPLLTTLLVQTAGAAVMGQMMATVGLPMILGPLIGPVIGGIIIKFASWHWIFWINVPVVLISIALILWKMPNYPAQNRTAKMDFIGILLLIVSSSAIIYSLVNAAHTDRFNNATSIEMLILGAIALISYVVWAAWQKERAVVPLHLFKFASFDGAGLGLFIAGTVLNGAMLLLPLYFQNVRGMSVINAALALLPQGAGMLVSRTLTGRLTDQIGAKYVVLGSVVITFVGTLPFYWFGQQTSYWILALILFVRGIGAGGILMPLMADAYTGMQPGQVPAATIGTRIIQNIGSAFGSALITTIVTAYSTHQVNVFERHLKAGTYHVDAAHLQVFTTSHLQAIRLAAFQQGFLVIAIAAIVIILPTLLLTNKLKAAK
>CP015126.1|AMX11413.1|2736196_2736436_-|hypothetical-protein
MKKVYLRYQKQVDSFININKIMLLLEFVLLFVVKGSIDHYNQLPYDWFAYLTTLIHYFLGTFAFFGIILVIECVWNKFK
>CP015126.1|AMX11922.1|2735758_2735950_+|hypothetical-protein
MAAFSEKQLKKAPITDQEFEKVVAVAKPDVQGIHSVCQQLVISFIAEERFLAVFGDGTCHPSN
>CP015126.1|AMX11412.1|2734293_2735247_-|aldo/keto-reductase
MKTIQIGASQLKASAVALGIMRMVRLDTDAAANVLETVHDRGVNFIDSADIYGNGDSERIFGQALKQSSLKREDFFIQSKGGIVLDPEKSSGELVFGQRYDFSKQHLIATVDKILQRMQLDYLDSFLLHRPDPLMDPAEVAAAFDELQATGKVRHFGVSNFNPMQVEMLQAAVSQKLMINQLQFGVMHTGPIQFGLHTNMQDTASLNHDGEIIEYSRLHHMTIQAWSPYQYGMFAGTFIDNPKFPELNAKLQELADQYHVTKNAIATAWILRHPANMQVILGSMNPQHLDESIAGTDVTLTRQEWYDVYFAAGNDLP
>CP015126.1|AMX11411.1|2733507_2734074_-|hypothetical-protein
MNKARLEAFTDAIIAIVLTLLVLDLPRPQTPSVRALFAEWQSIYVYIITFTLLISIWLNHHDLFVQVKKIDRVVFWANSFWLLCQSFIPFMASWITKFPHSKWPAVFYILTGFVWMLAYQLLVAAVRRLNPHIHRMSSPALSVVFGGFLVVLTVALINPDVGLFLIPVHAFASVILATKRKWHLRKYF
>CP015126.1|AMX11410.1|2732321_2733359_+|epimerase
MQKQLVVVTGGSGFIAIHIIRQLLQQGYAVRTTVRSLAKAPVIKEMLTNGGITDLSALEIVVADLAHDEHWSEAMAGATYAIDVASPTPKLNFKNKAEMIRPAVDGVRRVLTASRDAGVKRVVLTSAYGAIFAGHKNRTTPYTEADWSDLNWKAIHPYQESKTRAELAAWDFINHEGRGLELTTVNPVAVMGPVLSAKYSHSNIQIQQFLEGQVKAVPNVDSGYVDVRDVASLHLLAMTAPQANGERFLATTGETLSMLDVANVLRQAFPAFASQLPTKTIPNAAVKLAAKARPELRMVASLVGTYAETSNHKAQTLLDWHPRPAAESIIATAQSMIDLGIVTKP
>CP015126.1|AMX11409.1|2731628_2732195_-|TetR-family-transcriptional-regulator
MAATNHAQAIKKDSQTYLTTALLQLLRTHDLDTITVTQVVKRAGVSRMAFYRNFTTLEDLLTAYFAPAIAARFQDVLQHVPANRKLLAMGQFFSDFAPTLRLAEQRGFENIIQQLFNANMTNYYQATMTNGMLTAVQLKYWTRFMSAGVYAIWREWLLGGQLESLTTIHEILATLQTATMQALTQAQK
>CP015126.1|AMX11408.1|2730741_2731470_+|oxidoreductase
MKPLVVITGASSGFGAEIAKLFAADNYPLLLLGRRQAKLAALSANFENAMIDTVDVTNYHQFETAVRKAEAKYGKTDLLVNNAGLMLLGNVQNQDPQEWQTMLNTNVMGVLNGTQIVLNDMRDREHGTILNMSSLAGKKTFVNHAAYVASKFGVHGLSETLREENAPKNVRVMLVAPGAAETELLTHVTSKSALSDYEAWKASMGGLTLDPKHVAATVKFMYDMPQNVNIREVDIAATAQDA
>CP015126.1|AMX11407.1|2730243_2730609_-|hypothetical-protein
MLKERVTAQPRYRNEFDATMQLIRGKWKIMILFELAEVKVSRFADLQHHIQAVSHKTLASQLKELEQDELIERHDFKTAQPHVEYRLTAKGQSLIPILDAICTWGDQHVDPALIERSLCDE
>CP015126.1|AMX11406.1|2729675_2729960_+|hypothetical-protein
MKTYQFDAPIQAATIGKGGAYVACPFDIRDLFGKGRVKVHATFDEVPYNGSIVNMGVKNLDGSICYILGIRKDIRAKLHKSIGDVVAVTVTAID
>CP015126.1|AMX11415.1|2738362_2738962_+|TetR-family-transcriptional-regulator
MTKTRRRGAELENAIYQAARDILNQDGLEQLTFANVAEQAGTSKPVIYRRWRSPLELAIAAIQDQIITENHGQLDEVSLTGQTLSEDLFQVLKRFTVSINTFNQALVITWFHHLDQQANPEVKDLLNAVKKIDAHAIERVCQRAQQRGELRTGTLSCDLQLMPFDWLRYRAFANEPITDATLHLLVDDLLVPAYQHALG
>CP015126.1|AMX11923.1|2739082_2739964_-|ferrichrome-ABC-transporter-substrate-binding-protein
MGSLLLGACGAKQPTSTTVTRTDYLKHKVKVPKHPKRIVASYLEDDLVALGIKPVVQWSVKNGSGTQAYLKEQLKGVPLIDYSLPYEAVTKAKPDLILMGTSSAVANGKYAQYNKIVPTYVVKNGTTVTWRQTFLDVAKVVNRQAKAKKVLAKYDKQVQTTRQALKKSGQHKVAVLWVTNNTAYMVNDNSASGALLYQDLQLGEPSLVKQVSKSATADWSAVSLEKLAKLDADDIFLVNSQKSASLFKDPLWKNIKAVKNNHLYQYGDSSSWQYSGPIAYSQMIDMVKTDLLK
>CP015126.1|AMX11416.1|2740248_2741043_+|ABC-transporter-ATP-binding-protein
MNTIEAQNISIGYGDKVIVDQLSITIPHGQITTLIGPNGSGKSTLIRAIAHLLPPTTGVILLDHQNIQQIKSKTFAKKIAVLPQTNQTANDLTVEELVSFGRLPYRRPLSGLTTTDHQKIEWALTQASLQDLRQRPLSTLSGGQRQRAWIAMAVAQDTDTIILDEPTTYLDLTHQLEVMQLVKKLNEQAHRTIIMALHDLNHAARISDQLIALKDGHVLAHGPVSTVMTAANLKTIFNIDATLVDYHGTPLILTYNGCQEVAPA
>CP015126.1|AMX11417.1|2741039_2742038_+|ferrichrome-ABC-transporter-permease
MKSTSRYWGWLALSTGVLILVMGLSLRFGADQMRTATVWHALTTTHTGNLDQQIIRHIRVPRVLGAALIGAALAGSGALMQAVTRNPLADSGLLGINAGAGLMLTLCLAFFPKLSTLQTTGWAIIGAAASAGLIFSISTARHVQLDPTILVLAGIAISSLLTALSEGLALVLQLKQDLAFWYFGGLGAVSWTQLKFLGPGLVLGLLLTLLLAPQLNLAYLTDDNAQSLGKSLPLLRGLALICAVILSGISVALVGTITFVGLMIPHMARWLAGANYRNSMPLTLILGATLTVGADLIARLVNPPHETPFGIIISLIGVPCFIYLARKEPMKA
>CP015126.1|AMX11418.1|2742034_2743030_+|iron-ABC-transporter-permease
MSPNRRLIIWSLLLTASMLGLAILNLSTGTMTISWPALLGILTGRGNATDMLVLVNFRLPRIVLAIMVGWALALSGNVLQTVTNNPMADPSLLGINNGAGLAVMLLIIGAGTNASLTLSLPIVALAGAWLSTALIFLLANQRQRGISSKRLLLVGVALSGCFSALMVLMTLKLSPDNYQFVMNWLAGSLWGTDWSYIGWALPWLAVGSGILFIQLPVLDAFTLGTTTAQTLGINLKRQQLGLISVAAMLAGVSVAISGGISFIGLITPNLARRIVGSRQRYQLPLAGLLGSTLLLAADTLGKLITTTTELPAGVLVALIGAPYFIYLLVRG
>CP015126.1|AMX11419.1|2743274_2743787_+|TetR-family-transcriptional-regulator
MANQRNQRMQATILLAYENLLSDKPFRKITVQDISDAALVHRSTFYKHFQDQYDLLEALFEQKRQQSKLTIDQIFTHPFETLNSFGNARFQETLRHQFNDDAFRDAFLNYLIHLCKDTVDDDQRLVRFLAVGRIKGLTLWITVGNAPYNIFTDTATLDNIFSNPLNTVNY
>CP015126.1|AMX11420.1|2743767_2744661_-|short-chain-dehydrogenase
MKVFITGGTGFVGSAVVQELVANGFEVVGLARSETSAQKLISWGAQPVRGSLTSLSTLATAAAQADAIIHLGFNNDFRHFFQAGAMDRRAIETMGRAISGTNKPLVVTYGTTGIRKHVETEHEVADTGLLKWLTPRKSEIVARQLMAQNINAFVVRLSPAVHGAGDMGFTRTVIERAKKSHRAEYFGLGTHAWSAVHRLDAAHLFYLVTMYGLEHPTTNERVFNAVAEESITTAAIARTISRKLNVPLKAKYNPLSFGDTAMLYLINCPTSSQLTRQILGWVPVQPDLLTDISSSRY
>CP015126.1|AMX11421.1|2744954_2745701_-|oxidoreductase
MSIKGKVVVITGASSGIGAATAKLLAAKGAKVVLGARREERLQALSQAIGDNAVYQVTDVTDRQQVRALIDLAVSKFGRVDVLYNNAGTMPQGNLSDREYDKWQMMLNVNIMGVLNGIGEVLPIMQKQHDGLIIATDSVAGHVVYPASAVYNGTKYAVRAIMEGLRQEEKEHGIRSTIVSPGAVRTELVNTIGNTQIQAGISELMNADDRQGLALNPEDIANAVLFAIDQPKHVAISEVLVRPAQQEV
>CP015126.1|AMX11422.1|2745717_2746173_-|acetyltransferase
MNVTREPSEIRERLAEITGQTIDISVEIRVPLWTDYGRNLKIGKRIFINDNVQITDLGGIELADDVLIGPGAMLLSVNHPLDPAKRHAVEVQPIHIERNAWIGAGAKVLAGVTVGENAVVGAGAVVTKSVPANTVVAGVPAKVIKTIEQVD
>CP015126.1|AMX11423.1|2746482_2747319_+|short-chain-dehydrogenase
MQSKLAVIIGGTSGVGKHTAIDLANQNYHVIIVGSRADKGRQAQADISQATGNQAVQLALADLSTKTGVQQFAHQLAAMTDHIDILLNSIGVMLPERHLSADGYDLNLVLNYLTHFWTIQALLPLLKHSDQARILLVGALPFVINHAKVSLPDFDAPATSKYNAMTVTAQATAARVLLTLALSERLTATNVTINIFHPGYVPDSNFGAGGSWVSRLAGRILGESFSRKNSPIGAWLATAPELTHTSGHFYDDRLRQVRLSKQYTRSKANDLWRLSSQY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

297461 : 399866

Staphylococcus_phage(14.29%)

transposase,bacteriocin,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AMX09296.1\|297461_298724_+\|transposase	transposase	NA	NA	NA	NA
AMX09297.1\|299008_300325_-	sodium:solute symporter	NA	NA	NA	NA
AMX09298.1\|300494_301397_-	paraslipin	NA	NA	NA	NA
AMX09299.1\|301409_301610_-	hypothetical protein	NA	NA	NA	NA
AMX09300.1\|302292_303705_+	peptidase C69	NA	NA	NA	NA
AMX09301.1\|303770_304016_+	hypothetical protein	NA	NA	NA	NA
AMX09302.1\|304144_304708_+	biotin biosynthesis protein BioY	NA	NA	NA	NA
AMX09303.1\|304745_305717_+	bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor	NA	NA	NA	NA
AMX09304.1\|305705_305981_-	hypothetical protein	NA	NA	NA	NA
AMX09305.1\|306188_307364_+	aspartate aminotransferase	NA	NA	NA	NA
AMX09306.1\|307539_308706_-	hypothetical protein	NA	NA	NA	NA
AMX09307.1\|309300_310116_+	Teichoic acid translocation permease TagG	NA	NA	NA	NA
AMX09308.1\|310128_311220_+	teichoic acid ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.2e-18	29.7
AMX09309.1\|311598_311871_+	hypothetical protein	NA	NA	NA	NA
AMX09310.1\|312097_312640_+	PadR family transcriptional regulator	NA	NA	NA	NA
AMX09311.1\|312636_314082_+	multidrug MFS transporter	NA	NA	NA	NA
AMX09312.1\|314411_315728_-	ammonia permease	H8ZJB2	Ostreococcus_tauri_virus	3.3e-33	29.6
AMX09313.1\|316222_317182_+	L-lactate dehydrogenase	NA	NA	NA	NA
AMX09314.1\|317284_317554_+	hypothetical protein	NA	NA	NA	NA
AMX09315.1\|317784_318348_-	peptidase M10	NA	NA	NA	NA
AMX09316.1\|318541_319210_+	ribose-5-phosphate isomerase	NA	NA	NA	NA
AMX09317.1\|319367_320873_+	copper oxidase	NA	NA	NA	NA
AMX09318.1\|321137_321506_+	hypothetical protein	NA	NA	NA	NA
AMX09319.1\|321618_322128_-	hypothetical protein	NA	NA	NA	NA
AMX09320.1\|322158_323355_-	DNA replication initiation protein	NA	NA	NA	NA
AMX09321.1\|323464_323935_+	Rrf2 family transcriptional regulator	NA	NA	NA	NA
AMX09322.1\|323953_324409_+	hypothetical protein	NA	NA	NA	NA
AMX09323.1\|324512_325085_+	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit	NA	NA	NA	NA
AMX09324.1\|325250_326171_-	ribonucleoside hydrolase RihC	NA	NA	NA	NA
AMX09325.1\|326307_327219_+	short-chain dehydrogenase/reductase	NA	NA	NA	NA
AMX09326.1\|327965_328412_-	ribonuclease H	NA	NA	NA	NA
AMX09327.1\|328649_330176_+	glycine/betaine ABC transporter permease	NA	NA	NA	NA
AMX09328.1\|330176_331148_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-23	31.7
AMX09329.1\|331225_332557_+	glutathione reductase	NA	NA	NA	NA
AMX09330.1\|333022_334540_+	glycerol kinase	NA	NA	NA	NA
AMX09331.1\|334554_336384_+	alpha-glycerophosphate oxidase	NA	NA	NA	NA
AMX09332.1\|336401_337121_+	aquaporin	M1HWZ0	Paramecium_bursaria_Chlorella_virus	3.2e-30	31.9
AMX09333.1\|337703_338198_+	hypothetical protein	NA	NA	NA	NA
AMX11851.1\|339037_341386_+	cell surface protein precursor	NA	NA	NA	NA
AMX09334.1\|341387_343295_+	hypothetical protein	NA	NA	NA	NA
AMX09335.1\|343291_344209_+	hypothetical protein	NA	NA	NA	NA
AMX09336.1\|344252_344516_+	hypothetical protein	NA	NA	NA	NA
AMX09337.1\|344627_344906_+	hypothetical protein	NA	NA	NA	NA
AMX09338.1\|345285_345672_+	hypothetical protein	NA	NA	NA	NA
AMX09339.1\|346738_347146_+	hypothetical protein	NA	NA	NA	NA
AMX09340.1\|348416_348692_+	hypothetical protein	NA	NA	NA	NA
AMX09341.1\|349073_349691_-	maltose acetyltransferase	NA	NA	NA	NA
AMX09342.1\|349694_350849_-	MFS transporter	NA	NA	NA	NA
AMX09343.1\|350852_351644_-	HAD family hydrolase	NA	NA	NA	NA
AMX09344.1\|351714_352587_-	AraC family transcriptional regulator	NA	NA	NA	NA
AMX09345.1\|352746_353562_+	hydrolase	NA	NA	NA	NA
AMX09346.1\|354087_355464_+	branched-chain amino acid transporter II carrier protein	NA	NA	NA	NA
AMX09347.1\|355508_356693_+	sodium:proton antiporter	NA	NA	NA	NA
AMX09348.1\|357077_357281_+	hypothetical protein	NA	NA	NA	NA
AMX09349.1\|357692_358361_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AMX09350.1\|358357_358531_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09351.1\|358561_358729_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09352.1\|359590_359791_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AMX09353.1\|359918_360086_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09354.1\|360203_361403_+	pirin	NA	NA	NA	NA
AMX09355.1\|361433_362180_+\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AMX09356.1\|362533_362722_+	pirin	NA	NA	NA	NA
AMX09357.1\|363057_363204_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09358.1\|363394_364723_+	histidine kinase	NA	NA	NA	NA
AMX09359.1\|364723_365467_+	DNA-binding response regulator	NA	NA	NA	NA
AMX09360.1\|365585_366329_+	DNA-binding response regulator	NA	NA	NA	NA
AMX09361.1\|366633_367407_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
AMX09362.1\|367505_367664_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09363.1\|367688_367859_-\|bacteriocin	bacteriocin	NA	NA	NA	NA
AMX09364.1\|368125_370276_+	peptide ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.1e-45	27.9
AMX09365.1\|370291_371668_+\|bacteriocin	bacteriocin ABC transporter	NA	NA	NA	NA
AMX09366.1\|371902_372448_+	hypothetical protein	NA	NA	NA	NA
AMX09367.1\|372514_373183_+	hypothetical protein	NA	NA	NA	NA
AMX09368.1\|373269_373950_+	hypothetical protein	NA	NA	NA	NA
AMX09369.1\|374043_374730_+	hypothetical protein	NA	NA	NA	NA
AMX09370.1\|374867_375071_+	hypothetical protein	NA	NA	NA	NA
AMX09371.1\|375165_377475_-	ATP-dependent DNA helicase	NA	NA	NA	NA
AMX09372.1\|377733_378510_+	hydrolase	NA	NA	NA	NA
AMX09373.1\|378948_379965_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
AMX09374.1\|380372_381083_+	GntR family transcriptional regulator	NA	NA	NA	NA
AMX09375.1\|381155_382517_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AMX09376.1\|382523_382712_+	hypothetical protein	NA	NA	NA	NA
AMX09377.1\|382701_383124_+	hypothetical protein	NA	NA	NA	NA
AMX11852.1\|383346_384702_+	PTS cellobiose transporter subunit IIC	NA	NA	NA	NA
AMX09378.1\|384719_386156_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	9.7e-31	25.5
AMX09379.1\|386276_387173_+	transcriptional regulator	NA	NA	NA	NA
AMX09380.1\|387322_388069_+	RpiR family transcriptional regulator	NA	NA	NA	NA
AMX09381.1\|388181_389195_+\|tRNA	tRNA-dihydrouridine synthase	NA	NA	NA	NA
AMX09382.1\|389648_390782_+	hypothetical protein	NA	NA	NA	NA
AMX09383.1\|390786_391581_+	hypothetical protein	NA	NA	NA	NA
AMX09384.1\|391749_392667_+	exopolyphosphatase	NA	NA	NA	NA
AMX09385.1\|392712_393987_+	3-hydroxy-3-methylglutaryl-CoA reductase	NA	NA	NA	NA
AMX09386.1\|393979_394939_+	IpaB/EvcA family protein	NA	NA	NA	NA
AMX09387.1\|394960_395665_+	NAD-dependent protein deacylase	NA	NA	NA	NA
AMX09388.1\|395664_396507_+	hypothetical protein	NA	NA	NA	NA
AMX09389.1\|397064_397493_+	phosphohydrolase	NA	NA	NA	NA
AMX09390.1\|397814_399866_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	2.7e-90	35.8

DBSCAN-SWA_2

545307 : 630208

Lactobacillus_phage(35.9%)

portal,terminase,head,integrase,capsid,tRNA,tail,protease,holin

attL 538323:538337|attR 574438:574452

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
538323:538337	attL	NA	NA	NA	NA
AMX09504.1\|545307_546798_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
AMX09505.1\|547075_548488_+\|tRNA	cysteine--tRNA ligase	F1C979	Terra1_virus	1.5e-44	27.7
AMX09506.1\|548489_548900_+	Mini-ribonuclease 3	NA	NA	NA	NA
AMX09507.1\|548871_549657_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
AMX09508.1\|549658_550204_+	DNA-binding protein	NA	NA	NA	NA
AMX09509.1\|550710_551313_+	DNA-directed RNA polymerase	NA	NA	NA	NA
AMX09510.1\|551374_551524_+	50S ribosomal protein L33	NA	NA	NA	NA
AMX09511.1\|551535_551721_+	preprotein translocase subunit SecE	NA	NA	NA	NA
AMX09512.1\|551825_552374_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
AMX09513.1\|552401_553289_+	hydrolase	NA	NA	NA	NA
AMX09514.1\|553390_553816_+	50S ribosomal protein L11	NA	NA	NA	NA
AMX09515.1\|553916_554606_+	50S ribosomal protein L1	NA	NA	NA	NA
AMX09516.1\|554804_555308_+	50S ribosomal protein L10	NA	NA	NA	NA
AMX09517.1\|555369_555738_+	50S ribosomal protein L7/L12	NA	NA	NA	NA
AMX09518.1\|555889_557092_-\|integrase	integrase	A0A126GGK4	Streptococcus_phage	9.0e-38	29.5
AMX09519.1\|557471_558158_-	hypothetical protein	NA	NA	NA	NA
AMX09520.1\|558332_558911_-	hypothetical protein	NA	NA	NA	NA
AMX09521.1\|558960_560307_-	chromosome partitioning protein ParA	A0A1B0Y697	Lactobacillus_phage	3.5e-83	53.1
AMX09522.1\|560332_560746_-	hypothetical protein	A0A0M4RD70	Bacillus_phage	2.6e-05	31.3
AMX09523.1\|560757_561120_-	transcriptional regulator	A0A0U4KKM4	Exiguobacterium_phage	2.6e-09	32.0
AMX09524.1\|561594_561909_-	hypothetical protein	NA	NA	NA	NA
AMX09525.1\|561946_562183_-	transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-09	30.7
AMX09526.1\|562329_562530_+	transcriptional regulator	NA	NA	NA	NA
AMX09527.1\|562688_562871_+	hypothetical protein	NA	NA	NA	NA
AMX09528.1\|562931_563486_+	hypothetical protein	O03909	Lactobacillus_phage	3.6e-98	100.0
AMX09529.1\|563491_563776_+	hypothetical protein	NA	NA	NA	NA
AMX09530.1\|564096_564534_+	hypothetical protein	NA	NA	NA	NA
AMX09531.1\|564530_565418_+	recombinase RecT	E9LUM3	Lactobacillus_phage	2.5e-61	47.0
AMX11860.1\|565449_566202_+	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	6.3e-74	52.6
AMX09532.1\|566283_567216_+	DnaD domain protein	A0A0P0HRQ2	Lactobacillus_phage	1.1e-56	44.3
AMX09533.1\|567212_567500_+	hypothetical protein	NA	NA	NA	NA
AMX09534.1\|567496_568027_+	hypothetical protein	NA	NA	NA	NA
AMX09535.1\|568023_568557_+	hypothetical protein	O03915	Lactobacillus_phage	4.9e-36	51.7
AMX09536.1\|568549_568969_+	Holliday junction resolvase	A8YQM5	Lactobacillus_phage	2.8e-23	42.3
AMX09537.1\|568965_569196_+	hypothetical protein	O03916	Lactobacillus_phage	1.6e-20	57.9
AMX09538.1\|569332_569728_+	hypothetical protein	NA	NA	NA	NA
AMX09539.1\|570017_570290_+	hypothetical protein	Q6J1U7	Lactobacillus_phage	2.5e-12	47.6
AMX09540.1\|571046_571523_+	hypothetical protein	NA	NA	NA	NA
AMX09541.1\|572046_572817_+	hypothetical protein	NA	NA	NA	NA
AMX09542.1\|572963_573155_+	hypothetical protein	NA	NA	NA	NA
AMX09543.1\|573208_573805_+\|terminase	terminase	O03926	Lactobacillus_phage	1.5e-14	33.8
AMX09544.1\|573788_575075_+\|terminase	terminase	A0A2H4IYR5	uncultured_Caudovirales_phage	8.8e-116	50.6
574438:574452	attR	NA	NA	NA	NA
AMX11861.1\|575067_576723_+\|portal	portal protein	D2IZF6	Enterococcus_phage	1.7e-66	32.8
AMX09545.1\|576722_577667_+\|head	phage head morphogenesis protein	NA	NA	NA	NA
AMX09546.1\|577774_578422_+\|capsid	phage capsid protein	NA	NA	NA	NA
AMX09547.1\|578435_579506_+\|capsid	phage capsid protein	A0A0S0N2Q7	Pseudomonas_phage	2.0e-33	30.6
AMX09548.1\|579520_579886_+	hypothetical protein	H9A0V3	Staphylococcus_phage	3.0e-05	38.2
AMX09549.1\|579839_580214_+	hypothetical protein	NA	NA	NA	NA
AMX09550.1\|580203_580758_+\|tail	phage tail protein	NA	NA	NA	NA
AMX09551.1\|580758_581145_+	hypothetical protein	NA	NA	NA	NA
AMX09552.1\|581156_581744_+\|tail	phage tail protein	NA	NA	NA	NA
AMX09553.1\|581761_582274_+	hypothetical protein	NA	NA	NA	NA
AMX09554.1\|582342_582579_+	hypothetical protein	NA	NA	NA	NA
AMX09555.1\|582578_586583_+	tape measure protein	E9LUR1	Lactobacillus_phage	5.2e-82	44.3
AMX09556.1\|586576_587314_+\|tail	phage tail protein	A0A1S5SA63	Streptococcus_phage	4.1e-41	36.6
AMX09557.1\|589193_590186_+	lipase	A0A1J0MFI8	Staphylococcus_phage	9.1e-36	40.6
AMX09558.1\|590200_590815_+\|head	phage head protein	A0A1J0MFQ3	Staphylococcus_phage	7.3e-44	47.8
AMX09559.1\|590820_591561_+	hypothetical protein	NA	NA	NA	NA
AMX09560.1\|591561_591882_+	hypothetical protein	NA	NA	NA	NA
AMX09561.1\|592035_593184_+	lysin	O03950	Lactobacillus_phage	1.2e-50	35.7
AMX09562.1\|593184_593481_+	hypothetical protein	A0A1I9KK55	Lactobacillus_phage	4.4e-39	76.5
AMX09563.1\|593467_593827_+\|holin	holin	A0A2P0ZLG6	Lactobacillus_phage	1.5e-33	83.3
AMX09564.1\|594673_594880_-	hypothetical protein	NA	NA	NA	NA
AMX09565.1\|595268_596798_+	hypothetical protein	NA	NA	NA	NA
AMX09566.1\|597577_598555_-	hydroxyacid dehydrogenase	NA	NA	NA	NA
AMX09567.1\|598567_599236_-	cell surface protein	NA	NA	NA	NA
AMX09568.1\|599539_602143_+	hypothetical protein	NA	NA	NA	NA
AMX09569.1\|602317_602893_-	Rossman fold protein, TIGR00730 family	A0A1G5S9X4	Enterococcus_phage	6.4e-26	41.7
AMX09570.1\|602974_603985_-	ribonucleotide-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.1e-108	60.5
AMX09571.1\|604012_606178_-	ribonucleotide-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.2e-268	63.3
AMX09572.1\|606316_606547_-	NrdH-redoxin	X2KRY7	Enterococcus_phage	2.8e-09	40.0
AMX09573.1\|606769_607378_+	16S rRNA methyltransferase	NA	NA	NA	NA
AMX11862.1\|607407_607887_+\|tRNA	tRNA-specific adenosine deaminase	NA	NA	NA	NA
AMX09574.1\|608412_610110_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	3.0e-55	37.0
AMX09575.1\|610131_610440_+	nucleoid-associated protein	NA	NA	NA	NA
AMX09576.1\|610455_611055_+	recombination protein RecR	NA	NA	NA	NA
AMX09577.1\|611069_611321_+	hypothetical protein	NA	NA	NA	NA
AMX09578.1\|611718_612384_+	dTMP kinase	M1PSC7	Streptococcus_phage	1.4e-53	52.7
AMX09579.1\|612380_612710_+	hypothetical protein	NA	NA	NA	NA
AMX09580.1\|612726_613746_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	2.1e-32	33.5
AMX09581.1\|613770_614118_+	initiation-control protein	M1PFV3	Streptococcus_phage	2.4e-12	33.3
AMX09582.1\|614216_615113_+	rRNA (cytidine-2'-O-)-methyltransferase	M1PLC5	Streptococcus_phage	4.4e-82	55.7
AMX09583.1\|615116_615902_+	acyl-ACP thioesterase	NA	NA	NA	NA
AMX09584.1\|616040_617036_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.0e-51	38.5
AMX09585.1\|617169_618270_-	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
AMX09586.1\|618291_619089_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
AMX09587.1\|619113_619968_-	ABC transporter permease	NA	NA	NA	NA
AMX09588.1\|619964_620768_-	phosphonate ABC transporter permease	NA	NA	NA	NA
AMX09589.1\|620757_621528_-	phosphonate ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.9e-13	31.8
AMX09590.1\|621565_622618_-	phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
AMX09591.1\|622897_623623_+\|tRNA	tRNA threonylcarbamoyladenosine biosynthesis protein TsaB	NA	NA	NA	NA
AMX09592.1\|623606_624185_+	ribosomal-protein-alanine N-acetyltransferase RimI	NA	NA	NA	NA
AMX09593.1\|624177_624633_+	ribosomal-protein-alanine N-acetyltransferase RimI	NA	NA	NA	NA
AMX09594.1\|624637_625684_+\|tRNA	tRNA N6-adenosine(37)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.0e-61	41.4
AMX09595.1\|626570_628553_-	multidrug ABC transporter ATP-binding protein	A0A2K9L0W2	Tupanvirus	4.4e-50	29.2
AMX09596.1\|628721_629399_+	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
AMX09597.1\|629563_630208_-\|protease	CAAX protease	NA	NA	NA	NA

DBSCAN-SWA_3

819894 : 828897

Staphylococcus_virus(28.57%)

transposase,integrase

attL 810646:810660|attR 835968:835982

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
810646:810660	attL	NA	NA	NA	NA
AMX09743.1\|819894_821460_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.7e-17	29.8
AMX09744.1\|821525_823217_-\|transposase	transposase	A0ZS58	Staphylococcus_virus	1.1e-92	41.3
AMX09745.1\|823398_824574_-\|integrase	integrase	A0A1X9I5C3	Streptococcus_phage	2.6e-37	30.5
AMX09746.1\|824579_824765_-	hypothetical protein	NA	NA	NA	NA
AMX09747.1\|824879_825746_-	DNA-binding protein	Q4ZC41	Staphylococcus_virus	8.1e-81	57.5
AMX09748.1\|826004_826934_-	hypothetical protein	O48432	Lactobacillus_phage	3.1e-22	31.2
AMX09749.1\|826970_828107_-	hypothetical protein	O48432	Lactobacillus_phage	4.1e-16	26.3
AMX09750.1\|828152_828338_-	hypothetical protein	NA	NA	NA	NA
AMX09751.1\|828555_828897_-	hypothetical protein	A0A059T669	Listeria_phage	6.9e-20	53.9
835968:835982	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1295846 : 1308624

Lactobacillus_phage(70.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AMX10138.1\|1295846_1297085_+	hypothetical protein	A0A2P0ZL72	Lactobacillus_phage	2.4e-219	98.7
AMX10139.1\|1297175_1298147_-	peptidase S41	A0A2P0ZL68	Lactobacillus_phage	3.5e-181	98.5
AMX10140.1\|1298332_1299280_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.7e-178	100.0
AMX10141.1\|1299622_1300237_+	NADPH-dependent FMN reductase	A0A2P0ZL77	Lactobacillus_phage	6.3e-112	100.0
AMX10142.1\|1300239_1302678_+	flavocytochrome c	A0A2P0ZL82	Lactobacillus_phage	0.0e+00	99.5
AMX10143.1\|1302765_1303326_+	hypothetical protein	A0A2P0ZL75	Lactobacillus_phage	6.5e-100	98.4
AMX10144.1\|1303396_1303837_-	nucleoside 2-deoxyribosyltransferase	A0A2P0ZL88	Lactobacillus_phage	1.2e-75	97.9
AMX10145.1\|1304227_1305595_-	hypothetical protein	W8CYF6	Bacillus_phage	3.4e-25	31.0
AMX10146.1\|1305587_1306280_-	DNA-binding response regulator	W8CYM9	Bacillus_phage	5.3e-35	37.6
AMX10147.1\|1306989_1307655_+	hypothetical protein	NA	NA	NA	NA
AMX10148.1\|1307679_1308624_+	bactoprenol glucosyl transferase	V5USA4	Oenococcus_phage	2.0e-72	45.5

DBSCAN-SWA_5

2137294 : 2167806

Oenococcus_phage(47.83%)

portal,terminase,capsid,tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AMX10890.1\|2137294_2139025_-	multidrug ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-46	27.6
AMX10891.1\|2139248_2139641_-	hypothetical protein	NA	NA	NA	NA
AMX10892.1\|2139863_2140715_+	polysaccharide deacetylase	NA	NA	NA	NA
AMX10893.1\|2140711_2140870_-	cytochrome D ubiquinol oxidase	NA	NA	NA	NA
AMX10894.1\|2141636_2142173_-\|holin	holin	E9LUS0	Lactobacillus_phage	1.1e-35	97.6
AMX10895.1\|2142184_2142448_-\|holin	holin	E9LUR9	Lactobacillus_phage	2.0e-38	100.0
AMX10896.1\|2142447_2143620_-	endolysin	E9LUR8	Lactobacillus_phage	6.2e-201	89.7
AMX10897.1\|2143747_2144182_-	hypothetical protein	NA	NA	NA	NA
AMX10898.1\|2144184_2144634_-	hypothetical protein	A0A2P0ZLE0	Lactobacillus_phage	2.8e-21	40.5
AMX10899.1\|2144655_2149998_-	hypothetical protein	Q6SE68	Lactobacillus_prophage	2.4e-143	58.9
AMX10900.1\|2150012_2150375_-	hypothetical protein	V5UQS8	Oenococcus_phage	8.6e-45	71.2
AMX10901.1\|2150388_2156220_-\|tail	phage tail protein	V5URV5	Oenococcus_phage	4.1e-229	41.1
AMX11907.1\|2156235_2156499_-	hypothetical protein	V9QKH3	Oenococcus_phage	1.8e-23	65.4
AMX10902.1\|2156606_2157005_-	hypothetical protein	V9QJA0	Oenococcus_phage	3.0e-46	74.8
AMX10903.1\|2157104_2157581_-\|tail	phage tail protein	Q6SE73	Lactobacillus_prophage	1.0e-45	58.7
AMX10904.1\|2157589_2157955_-	hypothetical protein	V5UQS4	Oenococcus_phage	3.0e-29	53.4
AMX10905.1\|2157954_2158506_-	hypothetical protein	V5URV0	Oenococcus_phage	2.0e-64	61.7
AMX10906.1\|2158498_2158855_-	hypothetical protein	V5US85	Oenococcus_phage	3.2e-36	62.3
AMX10907.1\|2158854_2159187_-	hypothetical protein	V9QJ97	Oenococcus_phage	1.8e-12	45.3
AMX10908.1\|2159198_2159375_-	conjugal transfer protein	NA	NA	NA	NA
AMX10909.1\|2159387_2160410_-\|capsid	major capsid protein E	V5US24	Oenococcus_phage	3.7e-117	62.5
AMX10910.1\|2160429_2160780_-	hypothetical protein	V5UTH9	Oenococcus_phage	4.5e-30	63.8
AMX10911.1\|2160794_2161472_-	scaffolding protein	Q6SE80	Lactobacillus_prophage	4.6e-15	32.1
AMX10912.1\|2161644_2161851_-	hypothetical protein	NA	NA	NA	NA
AMX10913.1\|2161902_2162181_-	hypothetical protein	NA	NA	NA	NA
AMX10914.1\|2163987_2164284_-	hypothetical protein	D2J003	Enterococcus_phage	1.1e-10	40.2
AMX10915.1\|2164213_2165722_-\|portal	phage portal protein	V5US18	Oenococcus_phage	8.1e-137	52.2
AMX10916.1\|2165733_2166972_-\|terminase	terminase	M1PG09	Streptococcus_phage	2.9e-140	61.3
AMX10917.1\|2166961_2167558_-\|terminase	terminase	H9A0M8	Staphylococcus_phage	1.4e-12	42.3
AMX10918.1\|2167611_2167806_-	hypothetical protein	E9LUP6	Lactobacillus_phage	1.7e-07	58.0

DBSCAN-SWA_6

2171998 : 2181678

Lactobacillus_phage(55.56%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AMX10924.1\|2171998_2172517_-	hypothetical protein	O03915	Lactobacillus_phage	1.2e-55	69.1
AMX10925.1\|2172521_2173244_-	oxidoreductase	Q8SDM9	Staphylococcus_phage	8.0e-50	45.1
AMX10926.1\|2173240_2173528_-	hypothetical protein	NA	NA	NA	NA
AMX10927.1\|2173524_2174433_-	DNA replication protein DnaD	NA	NA	NA	NA
AMX10928.1\|2174513_2175326_-	hypothetical protein	A0A0P0IZH9	Lactobacillus_phage	2.4e-74	50.0
AMX10929.1\|2175297_2176197_-	recombinase RecT	E9LUM3	Lactobacillus_phage	3.5e-63	53.3
AMX10930.1\|2176193_2176631_-	hypothetical protein	NA	NA	NA	NA
AMX10931.1\|2176908_2177196_+	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	1.6e-22	48.9
AMX10932.1\|2177445_2177958_-	transcriptional regulator	D6PST4	Lactobacillus_phage	1.9e-29	45.3
AMX10933.1\|2178024_2178330_-	hypothetical protein	NA	NA	NA	NA
AMX10934.1\|2178536_2178833_-	hypothetical protein	NA	NA	NA	NA
AMX10935.1\|2178832_2179039_-	transcriptional regulator	NA	NA	NA	NA
AMX10936.1\|2179181_2179412_+	transcriptional regulator	A0A0K2CNE2	Brevibacillus_phage	8.5e-06	36.8
AMX10937.1\|2179417_2179912_+	hypothetical protein	NA	NA	NA	NA
AMX10938.1\|2180011_2180284_+	hypothetical protein	NA	NA	NA	NA
AMX10939.1\|2180280_2180478_-	hypothetical protein	NA	NA	NA	NA
AMX10940.1\|2180494_2180731_-	transcriptional regulator	NA	NA	NA	NA
AMX10941.1\|2180881_2181250_+	transcriptional regulator	E9LUL4	Lactobacillus_phage	5.7e-20	44.1
AMX10942.1\|2181261_2181678_+	hypothetical protein	A0A0M4RD70	Bacillus_phage	5.9e-05	30.6

DBSCAN-SWA_7

2389886 : 2398400

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
AMX11110.1\|2389886_2390465_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-21	33.9
AMX11111.1\|2390457_2391483_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	5.4e-60	40.7
AMX11112.1\|2391479_2392934_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.5e-50	34.0
AMX11113.1\|2392918_2395138_-	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	4.5e-144	39.3
AMX11914.1\|2395130_2395808_-	phosphoribosylformylglycinamidine synthase I	NA	NA	NA	NA
AMX11114.1\|2395810_2396065_-	phosphoribosylformylglycinamidine synthase	NA	NA	NA	NA
AMX11115.1\|2396066_2396798_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	M4SM18	Cyanophage	1.6e-37	37.3
AMX11116.1\|2396800_2397931_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
AMX11117.1\|2397914_2398400_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	2.3e-16	41.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage